DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dyrk2 and hipk1

DIOPT Version :9

Sequence 1:NP_001260456.1 Gene:Dyrk2 / 34831 FlyBaseID:FBgn0016930 Length:757 Species:Drosophila melanogaster
Sequence 2:XP_012819927.1 Gene:hipk1 / 734033 XenbaseID:XB-GENE-987412 Length:1218 Species:Xenopus tropicalis


Alignment Length:445 Identity:139/445 - (31%)
Similarity:225/445 - (50%) Gaps:66/445 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 TANTTNLGYDDDNGNYKIIEHD---HIAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNK 267
            |..||.....:..|:|::::|:   .:...||:||.:|:|:||||.:.....|...|||||::|.
 Frog   160 TTVTTKSSSSNGEGDYQLVQHEILCSMTNSYEVLEFLGRGTFGQVAKCWKRSTKEIVAIKILKNH 224

  Fly   268 KRFLNQAVVELNILDELREKDADGSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFS 332
            ..:..|..:|::||..|..::|| .:|.:...:....:.|.|:.||::..|||:.:|:|.::...
 Frog   225 PSYARQGQIEVSILSRLSSENAD-EYNFVRSYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLP 288

  Fly   333 MSLIRRFCNSIVKCLRLLYKENIIHCDLKPENILLKQ--RGSSSIKVIDFGSSCYVDRKI-YTYI 394
            :..||.....:...|..|....:||.|||||||:|..  |....:|||||||:.:|.:.: .||:
 Frog   289 LKYIRPILQQVATALMKLKSLGLIHADLKPENIMLVDPVRQPYRVKVIDFGSASHVSKAVCSTYL 353

  Fly   395 QSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVLISV 459
            |||:||:||:||||.:..|||||||||::|||:.|:||:||.:|.:|:..|.:..|||.:.|:|.
 Frog   354 QSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSA 418

  Fly   460 ARRRRLFF----------------DSRDAPRCITNTKGRKRSPGSKSLAHILHCQD--------- 499
            ..:...||                |..:....|.:.:.||         :|.:|.|         
 Frog   419 GTKTSRFFNRDPDLGYPLWRLKAPDEHEMETGIKSKEARK---------YIFNCLDDMAQVNMST 474

  Fly   500 --------------RYFIDFLQRCLEWDPAERMTPDEAAHHEF-----LQPSASSRH-RSC--RM 542
                          |.:||.|::.|..|..:|:||.:..:|.|     |.....|.| :||  .|
 Frog   475 DLEGTDMLAEKADRREYIDLLKKMLTIDADKRITPLKTLNHPFVTMTHLLDFPHSNHVKSCFQNM 539

  Fly   543 SSSSSSSGL-NSVSQKSSCYSFSEISPGTNGPVVASITS-TTAVHNAAIATTTKS 595
            ......|.: ::|:|..|.:: :.::|.|:..:..|..: ..:|||.|....:.|
 Frog   540 EICKRRSNMYDTVNQIKSPFT-THVAPNTSTNLTMSFNNQLNSVHNQASVLASSS 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dyrk2NP_001260456.1 PKc_DYRK4 186..529 CDD:271127 121/372 (33%)
S_TKc 233..529 CDD:214567 115/342 (34%)
hipk1XP_012819927.1 STKc_HIPK1 174..528 CDD:271130 118/363 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R968
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.