DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dyrk2 and clk2a

DIOPT Version :9

Sequence 1:NP_001260456.1 Gene:Dyrk2 / 34831 FlyBaseID:FBgn0016930 Length:757 Species:Drosophila melanogaster
Sequence 2:NP_001038344.1 Gene:clk2a / 558981 ZFINID:ZDB-GENE-030131-298 Length:526 Species:Danio rerio


Alignment Length:355 Identity:114/355 - (32%)
Similarity:195/355 - (54%) Gaps:32/355 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 DDDNGNYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDHKT-NTHVAIKIIRNKKRFLNQAVVEL 278
            ||:.|:......|.:..||||:..:|:|:||:|::.:||:. ..|||:|||:|.:::...|.:|:
Zfish   169 DDEEGHLICRSGDVLQERYEIVSTLGEGTFGRVMQCIDHRRGGAHVALKIIKNVEKYKEAARLEI 233

  Fly   279 NILDELREKDADGSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSLIRRFCNSI 343
            |:|:.:.|||.:.::..:.|.|:..:..|:||:|||::|:.::.:|:|||..:|::.:|.....:
Zfish   234 NVLERINEKDPENNNLCVQMFDWFDYHGHMCISFELLALSTFDFLKENNYLPYSINQVRHMAYQV 298

  Fly   344 VKCLRLLYKENIIHCDLKPENILL------------KQRG-----SSSIKVIDFGSSCYVDRKIY 391
            ...::.|::..:.|.||||||||.            |:|.     :::::|:||||:.:......
Zfish   299 CLAVKFLHENKLTHTDLKPENILFVNSDYTVTYNVEKKRDERTVKNTAVRVVDFGSATFDHEHHS 363

  Fly   392 TYIQSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVL 456
            |.:.:|.||:|||||.|.:....|:||:|.||.|.|.||.||...:..|.||.:..:||..|..:
Zfish   364 TIVSTRHYRAPEVILELGWSQPCDVWSIGSILFEYYLGFTLFQTHDNREHLAMMERILGPVPSRM 428

  Fly   457 ISVARRRRLFFDSR-------DAPRCI-TNTKGRKRSPGSKSLAHILHCQDRYFIDFLQRCLEWD 513
            |...|:::.|:..|       .|.|.: .|.|..:|...|::..|      ....|.::..||::
Zfish   429 IRKTRKQKYFYRGRLDWDENSSAGRYVRENCKPLRRYLLSEAEEH------HQLFDLIEAMLEYE 487

  Fly   514 PAERMTPDEAAHHEFLQPSASSRHRSCRMS 543
            |::|:|...|..|.|.|...||...|...|
Zfish   488 PSKRLTLAAALRHPFFQSGISSSELSAGKS 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dyrk2NP_001260456.1 PKc_DYRK4 186..529 CDD:271127 108/339 (32%)
S_TKc 233..529 CDD:214567 103/321 (32%)
clk2aNP_001038344.1 DUF1777 34..>117 CDD:285811
PRP38_assoc <37..104 CDD:289628
PKc_CLK2 174..503 CDD:271117 105/334 (31%)
S_TKc 187..503 CDD:214567 103/321 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.