DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dyrk2 and clk2

DIOPT Version :9

Sequence 1:NP_001260456.1 Gene:Dyrk2 / 34831 FlyBaseID:FBgn0016930 Length:757 Species:Drosophila melanogaster
Sequence 2:XP_031746276.1 Gene:clk2 / 496828 XenbaseID:XB-GENE-922501 Length:503 Species:Xenopus tropicalis


Alignment Length:345 Identity:110/345 - (31%)
Similarity:188/345 - (54%) Gaps:36/345 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 DDDNGNYKIIEH--DHIAFRYEILEVIGKGSFGQVIRALDHKT-NTHVAIKIIRNKKRFLNQAVV 276
            ||..|:  :|.|  |.:..||||:..:|:|:||:|::.:||:. ...||:|||:|.:::...|.:
 Frog   149 DDVEGH--LIYHSGDWLQERYEIVSTLGEGTFGRVVQCVDHRRGGARVALKIIKNVEKYKEAARL 211

  Fly   277 ELNILDELREKDADGSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSLIRRFCN 341
            |:|:|:::.|||.:..|..:.|.|:..:..|:||:|||:.|:.::.:|:|||..:.:..:|....
 Frog   212 EINVLEKINEKDPENKHLCVQMYDWFDYHGHMCISFELLGLSTFDFLKENNYFPYPIHQVRHMAL 276

  Fly   342 SIVKCLRLLYKENIIHCDLKPENILL------------KQRG-----SSSIKVIDFGSSCYVDRK 389
            .:.:.::.|:...:.|.||||||||.            |:|.     ::.|:|:||||:.:....
 Frog   277 QVCQAVKFLHDNKLTHTDLKPENILFVSSDYELTYNMEKKRDERCVKNTDIRVVDFGSATFDHEH 341

  Fly   390 IYTYIQSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPK 454
            ..|.:.:|.||:|||||.|.:....|:||:|||:.|.|.||.||...:..|.||.:..:||..|.
 Frog   342 HSTIVSTRHYRAPEVILELGWNQPCDVWSVGCIIFEYYVGFTLFQTHDNREHLAMMERILGPVPS 406

  Fly   455 VLISVARRRRLFF-------DSRDAPRCI-TNTKGRKRSPGSKSLAHILHCQDRYFIDFLQRCLE 511
            .::...|:::.|:       |:..|.|.: .|.|..:|....::..|      ......::..||
 Frog   407 RMVRKTRKQKYFYHGRLDWDDNTSAGRYVRENCKPLRRYMMMETEEH------HQLFSLIEGMLE 465

  Fly   512 WDPAERMTPDEAAHHEFLQP 531
            ::|::|||...|..|.|..|
 Frog   466 YEPSKRMTLAAALKHPFFSP 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dyrk2NP_001260456.1 PKc_DYRK4 186..529 CDD:271127 108/341 (32%)
S_TKc 233..529 CDD:214567 101/321 (31%)
clk2XP_031746276.1 PKc_CLK2 154..483 CDD:271117 105/336 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.