DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dyrk2 and clk4a

DIOPT Version :9

Sequence 1:NP_001260456.1 Gene:Dyrk2 / 34831 FlyBaseID:FBgn0016930 Length:757 Species:Drosophila melanogaster
Sequence 2:XP_003199888.1 Gene:clk4a / 321857 ZFINID:ZDB-GENE-030131-576 Length:496 Species:Danio rerio


Alignment Length:346 Identity:114/346 - (32%)
Similarity:181/346 - (52%) Gaps:28/346 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 DDDNGNYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDH-KTNTHVAIKIIRNKKRFLNQAVVEL 278
            ||:.|:......|.:..||||:..:|:|:||:|:..:|| |....:|:|||:|.:|:.:.|:.|:
Zfish   154 DDEEGHLVYHSGDMLRARYEIVCTLGEGAFGKVVECIDHEKVGARIALKIIKNIERYRDAALSEV 218

  Fly   279 NILDELREKDADGSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSLIRRFCNSI 343
            .:|:::...|.|..:..:.|.|:.....|:||.|||:.|:.|:.:|:||:..|.::.||.....|
Zfish   219 EVLEQINSLDCDRRYACVRMYDWFDHHGHICIAFELLGLSTYDFLKENNFQPFYINHIRHMAYQI 283

  Fly   344 VKCLRLLYKENIIHCDLKPENILL-----------------KQRGSSSIKVIDFGSSCYVDRKIY 391
            ::.:|.|:|..:.|.||||||||.                 :...:..:||:|||::.|......
Zfish   284 IRAVRFLHKNKLTHTDLKPENILFVNSEYNIRYNSKMKRDERTVKNPDVKVVDFGNATYEHEHHT 348

  Fly   392 TYIQSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVL 456
            :.:.:|.||:|||||.|.:..:.|:||:||||.|.|.|..||...:..|.||.:..|||..|..:
Zfish   349 SVVSTRHYRAPEVILDLGWSHSCDVWSVGCILIEYYLGSTLFQTHDSKEHLAMMERVLGPIPTHM 413

  Fly   457 ISVARRRRLFFDSRDAPRCITNTKGRKRSPGSKSLAHIL------HCQDRYFIDFLQRCLEWDPA 515
            :...|:.| |..:......|.::.||......|.|...|      |.|   ..|.::|.||:|..
Zfish   414 LQKTRKSR-FVRNDKLDWDIHSSSGRYVRKQCKPLRQYLVSSSSDHEQ---LFDLIERMLEYDVT 474

  Fly   516 ERMTPDEAAHHEFLQPSASSR 536
            :|:|.|||..|.|......|:
Zfish   475 KRITLDEAIKHPFFNSIRKSK 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dyrk2NP_001260456.1 PKc_DYRK4 186..529 CDD:271127 112/337 (33%)
S_TKc 233..529 CDD:214567 107/319 (34%)
clk4aXP_003199888.1 PKc_like 159..488 CDD:304357 109/332 (33%)
S_TKc 172..488 CDD:214567 107/319 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.