DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dyrk2 and Clk1

DIOPT Version :9

Sequence 1:NP_001260456.1 Gene:Dyrk2 / 34831 FlyBaseID:FBgn0016930 Length:757 Species:Drosophila melanogaster
Sequence 2:NP_001100383.2 Gene:Clk1 / 301434 RGDID:1311469 Length:483 Species:Rattus norvegicus


Alignment Length:430 Identity:138/430 - (32%)
Similarity:206/430 - (47%) Gaps:68/430 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 ERGSSTKSNSSSGSGSSGNSASSTGSGELKCNTPMTPSELVKKFRNYLTDLEFEELKVYKEVWYF 192
            |.||..:::||..||.||.|:                                     ||.....
  Rat    91 EPGSRYQNHSSKSSGRSGRSS-------------------------------------YKSKHRS 118

  Fly   193 GQHAS--KNYNKPAPTANTTNLGYDDDNGNYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDHKT 255
            ..|.|  :::.|......:.:: .||:.|:......|.::.||||::.:|:|:||:|:..:|||.
  Rat   119 HHHTSHRRSHGKSHRRKRSRSV-EDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECIDHKV 182

  Fly   256 -NTHVAIKIIRNKKRFLNQAVVELNILDELREKDADGSHNVIHMLDYTYFRKHLCITFELMSLNL 319
             ..|||:||::|..|:...|..|:.:|:.|...|...:...:.||::...|.|:||.|||:.|:.
  Rat   183 GGRHVAVKIVKNVDRYCEAAQSEIQVLEHLNATDPHSTFRCVQMLEWFEHRGHICIVFELLGLST 247

  Fly   320 YELIKKNNYNGFSMSLIRRFCNSIVKCLRLLYKENIIHCDLKPENILLKQRG------------- 371
            |:.||:|::..|.|..||:....|.|.:..|:...:.|.||||||||..:..             
  Rat   248 YDFIKENSFLPFRMDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVKSDYTEAYNPKMKRDE 312

  Fly   372 ----SSSIKVIDFGSSCYVDRKIYTYIQSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPL 432
                :..|||:||||:.|.|....|.:.:|.||:|||||.|.:....|:||:||||.|.|.||.:
  Rat   313 RTIVNPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCDVWSIGCILIEYYLGFTV 377

  Fly   433 FPGENEVEQLACIMEVLGLPPKVLISVARRRRLFFDSR---DAPRCITNTKGRKRSPGSKSLAHI 494
            ||..:..|.||.:..:||..||.:|...|:|..|...|   |.    .::.||..|...|.|...
  Rat   378 FPTHDSREHLAMMERILGPLPKHMIEKTRKRTYFHHDRLDWDE----HSSAGRYVSRRCKPLKEF 438

  Fly   495 LHCQD---RYFIDFLQRCLEWDPAERMTPDEAAHHEFLQP 531
            :..||   ....|.:.:.||:|||:|:|..||..|.|..|
  Rat   439 MLSQDAEHELLFDLIGKMLEYDPAKRITLKEALKHPFFYP 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dyrk2NP_001260456.1 PKc_DYRK4 186..529 CDD:271127 126/368 (34%)
S_TKc 233..529 CDD:214567 116/319 (36%)
Clk1NP_001100383.2 PKc_CLK1_4 147..476 CDD:271115 118/332 (36%)
S_TKc 160..476 CDD:214567 116/319 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.