DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dyrk2 and Clk4

DIOPT Version :9

Sequence 1:NP_001260456.1 Gene:Dyrk2 / 34831 FlyBaseID:FBgn0016930 Length:757 Species:Drosophila melanogaster
Sequence 2:XP_038941309.1 Gene:Clk4 / 287269 RGDID:1310274 Length:507 Species:Rattus norvegicus


Alignment Length:342 Identity:116/342 - (33%)
Similarity:179/342 - (52%) Gaps:36/342 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 DDDNGNYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDH-KTNTHVAIKIIRNKKRFLNQAVVEL 278
            ||:.|:......|.:..||||::.:|:|:||:|:..:|| ....|||:||::|..|:...|..|:
  Rat   167 DDEEGHLICQSGDVLRARYEIVDTLGEGAFGKVVECIDHGMDGLHVAVKIVKNVGRYREAARSEI 231

  Fly   279 NILDELREKDADGSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSLIRRFCNSI 343
            .:|:.|...|.:.....:.||::.....|:||.|||:.|:.|:.||:|::..|.:..||:....|
  Rat   232 QVLEHLNSTDPNSVFRCVQMLEWFDHHGHVCIVFELLGLSTYDFIKENSFLPFQIDHIRQMAYQI 296

  Fly   344 VKCLRLLYKENIIHCDLKPENILL-----------------KQRGSSSIKVIDFGSSCYVDRKIY 391
            .:.:..|:...:.|.||||||||.                 :...::.|||:||||:.|.|....
  Rat   297 CQSINFLHHNKLTHTDLKPENILFVKSDYVVKYNSKMKRDERTLKNTDIKVVDFGSATYDDEHHS 361

  Fly   392 TYIQSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVL 456
            |.:.:|.||:|||||.|.:....|:||:||||.|.|.||.:|...:..|.||.:..:||..|..:
  Rat   362 TLVSTRHYRAPEVILALGWSQPCDVWSIGCILIEYYLGFTVFQTHDSKEHLAMMERILGPIPAHM 426

  Fly   457 ISVARRRRLFFDSR-------DAPRCITNTKGRKRSPGSKSLAHILHCQD---RYFIDFLQRCLE 511
            |...|:|:.|..::       .|.|.:     |:|   .|.|...:.|.|   ....|.::|.||
  Rat   427 IQKTRKRKYFHHNQLDWDEHSSAGRYV-----RRR---CKPLKEFMLCHDEEHEKLFDLVRRMLE 483

  Fly   512 WDPAERMTPDEAAHHEF 528
            :||.:|:|.|||..|.|
  Rat   484 YDPTKRITLDEALQHPF 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dyrk2NP_001260456.1 PKc_DYRK4 186..529 CDD:271127 116/342 (34%)
S_TKc 233..529 CDD:214567 111/324 (34%)
Clk4XP_038941309.1 PKc_CLK1_4 172..501 CDD:271115 113/337 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.