DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dyrk2 and C36B7.1

DIOPT Version :9

Sequence 1:NP_001260456.1 Gene:Dyrk2 / 34831 FlyBaseID:FBgn0016930 Length:757 Species:Drosophila melanogaster
Sequence 2:NP_509199.1 Gene:C36B7.1 / 183253 WormBaseID:WBGene00016464 Length:450 Species:Caenorhabditis elegans


Alignment Length:398 Identity:128/398 - (32%)
Similarity:189/398 - (47%) Gaps:44/398 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 MTPSELVKKFRNYLTDLEFEELKVYKEVWYFGQHASKNYNKPAPTANTTN--LG-YDDDNGNYKI 223
            :.|.:....:.:.||..|..|::.|..|:..|.:.||         |.||  || :...||:|..
 Worm    66 LIPQQASLVYLHQLTSYEKREIEDYPIVYTVGDYGSK---------NQTNHELGIFTLPNGSYCF 121

  Fly   224 IEHDHIAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVVELNILDELREKD 288
            .|.|||::||.|.||:..|.:.||.|..|.||:..|.||:   |.|.|:....|..||..:.:.:
 Worm   122 KEGDHISYRYSIDEVLSSGYYAQVFRCTDKKTDKKVCIKL---KNRNLSTTYEETIILLRIHQLN 183

  Fly   289 ADGSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSLIRRF---CNSIVKCLRLL 350
            ...:.|.:.||||.:||.|..|..|....:|...:     .|.|....|.:   ..|||..|:.|
 Worm   184 RQNNSNCVRMLDYDHFRGHHFIVLENYQTDLASYL-----CGRSKLTPREYIPMIKSIVHGLKFL 243

  Fly   351 YKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCYVDR-KIYTYIQSRFYRSPEVILGLQYGTAI 414
            ::..|||.||||.|:||.:...:::|:.|||.|.:|:: ..:...|:.:|::|||....:....|
 Worm   244 HQNKIIHGDLKPANVLLNEWNRNNLKLTDFGLSTFVNQGPFFRDYQTLYYKAPEVFCQGKVSVEI 308

  Fly   415 DMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVLISVARRRRLFFDSRDAPR-C--- 475
            |:|||||:.||:..|.|||.|:|..:|.|.|.|..|.|.:.|.:.......|:.....|| |   
 Worm   309 DIWSLGCVAAEIVRGTPLFVGDNYFDQFALIQEFFGKPSRKLFNTWGGIHQFYTEYFFPRHCFEW 373

  Fly   476 ITNTKG---------------RKRSPGSKSLAHILHCQDRYFI-DFLQRCLEWDPAERMTPDEAA 524
            :....|               .::.|.:.||...|...::.|: .||.||.||||.||:......
 Worm   374 LNPFNGDRTMEIEPHYKLAHPSRKPPLTSSLVSKLPGGNQKFLARFLMRCFEWDPTERIKSSFIL 438

  Fly   525 HHEFLQPS 532
            :|.|...|
 Worm   439 NHPFFHES 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dyrk2NP_001260456.1 PKc_DYRK4 186..529 CDD:271127 121/369 (33%)
S_TKc 233..529 CDD:214567 103/319 (32%)
C36B7.1NP_509199.1 PKc_like 117..443 CDD:389743 110/333 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24058
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.