DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dyrk2 and Clk3

DIOPT Version :9

Sequence 1:NP_001260456.1 Gene:Dyrk2 / 34831 FlyBaseID:FBgn0016930 Length:757 Species:Drosophila melanogaster
Sequence 2:XP_006243208.1 Gene:Clk3 / 171305 RGDID:621259 Length:640 Species:Rattus norvegicus


Alignment Length:354 Identity:122/354 - (34%)
Similarity:182/354 - (51%) Gaps:35/354 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 DDDNGNYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDH-KTNTHVAIKIIRNKKRFLNQAVVEL 278
            ||..|:......|.:..||||:..:|:|:||:|:..||| :..:.||:|||||..::...|.:|:
  Rat   288 DDKEGHLVCRIGDWLQERYEIVGNLGEGTFGKVVECLDHARGKSQVALKIIRNVGKYREAARLEI 352

  Fly   279 NILDELREKDADGSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSLIRRFCNSI 343
            |:|.:::|||.:.....:.|.|:..|..|:||.|||:..|.:|.:|:||:..:.:..:|.....:
  Rat   353 NVLKKIKEKDKENKFLCVLMSDWFNFHGHMCIAFELLGKNTFEFLKENNFQPYPLPHVRHMAYQL 417

  Fly   344 VKCLRLLYKENIIHCDLKPENILL-----------------KQRGSSSIKVIDFGSSCYVDRKIY 391
            ...||.|::..:.|.||||||||.                 |...::||:|.||||:.:......
  Rat   418 CHALRFLHENQLTHTDLKPENILFVNSEFETLYNEHKSCEEKSVKNTSIRVADFGSATFDHEHHT 482

  Fly   392 TYIQSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVL 456
            |.:.:|.||.|||||.|.:....|:||:||||.|.|.||.||......|.|..:.::||..|..:
  Rat   483 TIVATRHYRPPEVILELGWAQPCDVWSIGCILFEYYRGFTLFQTHENREHLVMMEKILGPIPSHM 547

  Fly   457 ISVARRRRLFF--------DSRDAPRCITNTKGRKRSPGSKSLAHILHCQDRYFIDFLQRCLEWD 513
            |...|:::.|:        :|.|......|.|..|......||.|:      ...|.::|.||:|
  Rat   548 IHRTRKQKYFYKGGLVWDENSSDGRYVKENCKPLKSYMLQDSLEHV------QLFDLMRRMLEFD 606

  Fly   514 PAERMTPDEAAHHEF---LQPSASSRHRS 539
            ||:|:|..||..|.|   |.|...|.|.|
  Rat   607 PAQRITLAEALLHPFFAGLTPEERSFHSS 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dyrk2NP_001260456.1 PKc_DYRK4 186..529 CDD:271127 117/342 (34%)
S_TKc 233..529 CDD:214567 112/324 (35%)
Clk3XP_006243208.1 PHA03247 29..>162 CDD:223021
PKc_CLK3 292..622 CDD:271116 114/335 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.