DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dyrk2 and Clk4

DIOPT Version :9

Sequence 1:NP_001260456.1 Gene:Dyrk2 / 34831 FlyBaseID:FBgn0016930 Length:757 Species:Drosophila melanogaster
Sequence 2:XP_017169732.1 Gene:Clk4 / 12750 MGIID:1098551 Length:510 Species:Mus musculus


Alignment Length:406 Identity:127/406 - (31%)
Similarity:198/406 - (48%) Gaps:67/406 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 RNYLTDLEFEELKVYKEVWYFGQHASKN------------YNKPAPTANTTNLGY---------D 215
            |:|..|:|    ..|:      .|.||:            .|:|..:..:.:..:         |
Mouse   116 RHYHRDVE----STYR------IHCSKSSVRSRRSSPKRKRNRPCASHQSHSKSHRRKRSRSIED 170

  Fly   216 DDNGNYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDH-KTNTHVAIKIIRNKKRFLNQAVVELN 279
            |:.|:......|.:..||||::.:|:|:||:|:..:|| ....|||:||::|..|:...|..|:.
Mouse   171 DEEGHLICQSGDVLRARYEIVDTLGEGAFGKVVECIDHGMDGLHVAVKIVKNVGRYREAARSEIQ 235

  Fly   280 ILDELREKDADGSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSLIRRFCNSIV 344
            :|:.|...|.:.....:.||::.....|:||.|||:.|:.|:.||:|::..|.:..||:....|.
Mouse   236 VLEHLNSTDPNSVFRCVQMLEWFDHHGHVCIVFELLGLSTYDFIKENSFLPFQIDHIRQMAYQIC 300

  Fly   345 KCLRLLYKENIIHCDLKPENILL-----------------KQRGSSSIKVIDFGSSCYVDRKIYT 392
            :.:..|:...:.|.||||||||.                 :...::.|||:||||:.|.|....|
Mouse   301 QSINFLHHNKLTHTDLKPENILFVKSDYVVKYNSKMKRDERTLKNTDIKVVDFGSATYDDEHHST 365

  Fly   393 YIQSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVLI 457
            .:.:|.||:|||||.|.:....|:||:||||.|.|.||.:|...:..|.||.:..:||..|..:|
Mouse   366 LVSTRHYRAPEVILALGWSQPCDVWSIGCILIEYYLGFTVFQTHDSKEHLAMMERILGPIPAHMI 430

  Fly   458 SVARRRRLFFDSR-------DAPRCITNTKGRKRSPGSKSLAHILHCQD---RYFIDFLQRCLEW 512
            ...|:|:.|..::       .|.|.:     |:|   .|.|...:.|.|   ....|.::|.||:
Mouse   431 QKTRKRKYFHHNQLDWDEHSSAGRYV-----RRR---CKPLKEFMLCHDEEHEKLFDLVRRMLEY 487

  Fly   513 DPAERMTPDEAAHHEF 528
            |||.|:|.|||..|.|
Mouse   488 DPARRITLDEALQHPF 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dyrk2NP_001260456.1 PKc_DYRK4 186..529 CDD:271127 123/392 (31%)
S_TKc 233..529 CDD:214567 112/324 (35%)
Clk4XP_017169732.1 PKc_CLK1_4 175..504 CDD:271115 114/337 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.