DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dyrk2 and Clk2

DIOPT Version :9

Sequence 1:NP_001260456.1 Gene:Dyrk2 / 34831 FlyBaseID:FBgn0016930 Length:757 Species:Drosophila melanogaster
Sequence 2:NP_031738.2 Gene:Clk2 / 12748 MGIID:1098669 Length:499 Species:Mus musculus


Alignment Length:342 Identity:114/342 - (33%)
Similarity:190/342 - (55%) Gaps:36/342 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 DDDNGNYKIIEH--DHIAFRYEILEVIGKGSFGQVIRALDHKT-NTHVAIKIIRNKKRFLNQAVV 276
            ||..|:  :|.|  |.:..||||:..:|:|:||:|::.:||:. .|.||:|||:|.:::...|.:
Mouse   144 DDAEGH--LIYHVGDWLQERYEIVSTLGEGTFGRVVQCVDHRRGGTQVALKIIKNVEKYKEAARL 206

  Fly   277 ELNILDELREKDADGSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSLIRRFCN 341
            |:|:|:::.|||.|..:..:.|.|:..:..|:||:|||:.|:.::.:|.|||..:.:..:|....
Mouse   207 EINVLEKINEKDPDNKNLCVQMFDWFDYHGHMCISFELLGLSTFDFLKDNNYLPYPIHQVRHMAF 271

  Fly   342 SIVKCLRLLYKENIIHCDLKPENILL------------KQRG-----SSSIKVIDFGSSCYVDRK 389
            .:.:.::.|:...:.|.||||||||.            |:|.     |::::|:||||:.:....
Mouse   272 QLCQAVKFLHDNKLTHTDLKPENILFVNSDYELTYNLEKKRDERSVKSTAVRVVDFGSATFDHEH 336

  Fly   390 IYTYIQSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPK 454
            ..|.:.:|.||:|||||.|.:....|:||:|||:.|.|.||.||...:..|.||.:..:||..|.
Mouse   337 HSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPVPS 401

  Fly   455 VLISVARRRRLFFDSR-------DAPRCI-TNTKGRKRSPGSKSLAHILHCQDRYFIDFLQRCLE 511
            .:|...|:::.|:..|       .|.|.: .|.|..:|...|::..|      ....|.::..||
Mouse   402 RMIRKTRKQKYFYRGRLDWDENTSAGRYVRENCKPLRRYLTSEAEDH------HQLFDLIENMLE 460

  Fly   512 WDPAERMTPDEAAHHEF 528
            ::||:|:|..||..|.|
Mouse   461 YEPAKRLTLGEALQHPF 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dyrk2NP_001260456.1 PKc_DYRK4 186..529 CDD:271127 114/342 (33%)
S_TKc 233..529 CDD:214567 107/322 (33%)
Clk2NP_031738.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..65
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 102..142
PKc_CLK2 149..478 CDD:271117 111/337 (33%)
S_TKc 162..478 CDD:214567 107/322 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.