DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43333 and Postn

DIOPT Version :9

Sequence 1:NP_788051.1 Gene:CG43333 / 34830 FlyBaseID:FBgn0263038 Length:1166 Species:Drosophila melanogaster
Sequence 2:NP_001355607.1 Gene:Postn / 50706 MGIID:1926321 Length:838 Species:Mus musculus


Alignment Length:276 Identity:74/276 - (26%)
Similarity:116/276 - (42%) Gaps:46/276 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   899 QSGLDSILNETGPYTIFVPTDKAFKNLLVQLGGPERAEEKFQSNPRLLSGLLLHHVIPGAFEIAT 963
            |.||.|.|...|.||:..|.:.||            :::....:.|||..:|.:|::.....::.
Mouse   392 QLGLASSLKPDGEYTLLAPVNNAF------------SDDTLSMDQRLLKLILQNHILKVKVGLSD 444

  Fly   964 LQDEMTGVSLAGTQLRVNQYNMHDQEWNDVTLTTINGAMVVLNKKDIKIPQGVAHAVDRVMFPLP 1028
            |.:.....::.|.||||..|.         |...|..:.:|...|..:  .|..|....::.|..
Mouse   445 LYNGQILETIGGKQLRVFVYR---------TAICIENSCMVRGSKQGR--NGAIHIFREIIQPAE 498

  Fly  1029 VGDILQTLQSDREGRFSNFLKILYTSGLSEKLQSKGVKTYTVFAPVDKSFSELDSDTLEKLYNDK 1093
             ..:...|:.|:  |||.||.:|..:.|.:.|...|  .:|:|||.:.:|..:.|:..|.|..||
Mouse   499 -KSLHDKLRQDK--RFSIFLSLLEAADLKDLLTQPG--DWTLFAPTNDAFKGMTSEERELLIGDK 558

  Fly  1094 DTAEQFAMKHIVPGALFSAGMRFYQVKDSLSTGKTVILQKTSAGKI---------KVNDAQMVTS 1149
            :..:...:.|:.||.....|         ...|.|.||:.|...||         .||:.:...|
Mouse   559 NALQNIILYHLTPGVYIGKG---------FEPGVTNILKTTQGSKIYLKGVNETLLVNELKSKES 614

  Fly  1150 NIPATNGVIHALDGVL 1165
            :|..||||||.:|.:|
Mouse   615 DIMTTNGVIHVVDKLL 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43333NP_788051.1 FAS1 844..1026 CDD:225214 29/126 (23%)
Fasciclin 889..1026 CDD:280607 29/126 (23%)
Fasciclin 1042..1165 CDD:280607 41/131 (31%)
PostnNP_001355607.1 Fasciclin 111..232 CDD:308211
Fasciclin 247..369 CDD:308211
Fasciclin 384..496 CDD:308211 29/126 (23%)
Fasciclin 509..632 CDD:308211 42/135 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 811..838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10498
eggNOG 1 0.900 - - E1_COG2335
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100594
Panther 1 1.100 - - O PTHR10900
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.770

Return to query results.
Submit another query.