DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43333 and CG5758

DIOPT Version :9

Sequence 1:NP_788051.1 Gene:CG43333 / 34830 FlyBaseID:FBgn0263038 Length:1166 Species:Drosophila melanogaster
Sequence 2:NP_001286028.1 Gene:CG5758 / 35083 FlyBaseID:FBgn0032666 Length:625 Species:Drosophila melanogaster


Alignment Length:428 Identity:92/428 - (21%)
Similarity:166/428 - (38%) Gaps:86/428 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   783 HNLIFES-STSHVNAASLIRTTTSPIYGGSTVTVSPYLEGVSTHLPVVTERLSDVANNAELLPPI 846
            |.::|.. ..||.|...|         .|..:          .|...:.|.|..:|.:..|....
  Fly   158 HKIVFRKLEKSHNNVWLL---------NGQQI----------LHKLRINENLMAIAIDGYLGDRK 203

  Fly   847 PQYADALVQETEN-------------TEKAAQANPPTSSVLSNPSEDLLQILKTNGLFAMAKYLR 898
            ..|:...:|||.|             |...|:..|......::|....|..:|| |......:|.
  Fly   204 SPYSKRNIQETNNRYNDPQPLEQPNITNAHAKVEPVIKESKASPLMSFLANMKT-GTKVFQHFLS 267

  Fly   899 QSGLDSILNETGPYTIFVPTDKAFKNLLVQLGGPERAEEKFQ--SNPRLLSGLLLHHVIP--GAF 959
            :|.|..|:::.. ||:.:|:|.||:..       ...:..|.  |.|.....:|.:|.:|  ...
  Fly   268 KSNLTRIMDDNA-YTVLIPSDNAFQRW-------HPIDWGFYPFSVPEFTESVLRNHFLPMQRPL 324

  Fly   960 EIATLQ--DEMTGVSLAGTQL--------RVNQYNMHDQEWNDVTLTTINGAMVVLNKKDIKIPQ 1014
            .:|.::  ||:...::.|..:        .||..::    .:|..|:  ||..|.:..:.:.:.:
  Fly   325 RLADVRNMDEVVVTTMGGEDVVFHGQPTPTVNNVSI----MSDYNLS--NGNQVFIISEVLFVTE 383

  Fly  1015 GVA---HAVDR-------VMFPLPVGDIL--QTLQSDREGRFSNFLKILYTSGLSEKLQSKGVKT 1067
            .|.   |.:.:       :.||......|  ..|..:|:.||:...:.|.::.::..:..   ..
  Fly   384 AVVSKLHQMHKDKETPPLLAFPWFGAQFLSHSFLALERDPRFTQITRYLNSAEIAPHISG---AN 445

  Fly  1068 YTVFAPVDKSFSELDSDTLEKLYNDKDTAEQFAMK----HIVPGALFSAGMRFYQVKDSLSTGKT 1128
            ||.|.|.|::|.:...|.|    :|:..|.|..:|    |.|.|.|::..:|..:|.:::..|..
  Fly   446 YTFFVPEDRAFEKQGFDKL----SDEVMASQRGVKMLLNHFVKGRLYNRDLRDNEVFETIGGGHI 506

  Fly  1129 VILQKTSAGKIKVNDAQMVTSNIPATN-GVIHALDGVL 1165
            .|.:...:....||:||:..|.:...| |.::.||.:|
  Fly   507 KITRNPGSNYTSVNNAQITESEVFVYNLGTMYYLDDIL 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43333NP_788051.1 FAS1 844..1026 CDD:225214 42/218 (19%)
Fasciclin 889..1026 CDD:280607 30/160 (19%)
Fasciclin 1042..1165 CDD:280607 32/127 (25%)
CG5758NP_001286028.1 FAS1 281..380 CDD:214719 22/111 (20%)
FAS1 447..545 CDD:214719 29/102 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456377
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10900
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.