DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15293 and CG31769

DIOPT Version :9

Sequence 1:NP_001285925.1 Gene:CG15293 / 34828 FlyBaseID:FBgn0028526 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_723866.2 Gene:CG31769 / 318934 FlyBaseID:FBgn0051769 Length:311 Species:Drosophila melanogaster


Alignment Length:346 Identity:93/346 - (26%)
Similarity:154/346 - (44%) Gaps:66/346 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQYSYLLAICVSLLLLKLKGAAATSLSAEPTPELLNAAKQIGLDEVGLREMWHSQQPLVIRTQND 65
            |.:...|.:|:| |||:|:..|...:.....|.:...|:...:.|..:..|..:::|.::.....
  Fly     1 MNFESHLIVCIS-LLLQLRMGATMPMERPLPPSVYAQARHWNVLETVVNNMRITKRPWIVTKTKP 64

  Fly    66 AGQVTTLTYELGPDFRSILRRK-----VSEGILPARLEDNSGSKPQQDWEYVPSAGRQFRP---I 122
            .|:|...||.|.|:...::||.     .::|.|...|.                   ||:|   :
  Fly    65 CGEVIRETYMLSPNEEELIRRTEVMLLQAQGKLECLLS-------------------QFQPTLRL 110

  Fly   123 GD-------SNFGTGNFETKIFSTEFPRFPNWELPAGVTPKVTTKTETDSSGRKVTTTTRTYSGI 180
            |.       :..|.|..:..:|. .||..|.:: |..:.|:.....| ::..|:........:..
  Fly   111 GSVYNNPFLNPVGFGFPDYNVFQ-NFPFIPEFK-PQRIPPEEDRSNE-NNPRREDPRVNEQDAWN 172

  Fly   181 LVPGSNVFKQIFPDISREPGPI---NTDSNHPAENPNTSVFSPSRS-PSTGPIDFNYVYNSRPSQ 241
            |.|         .|:.:|...|   .:||:....|| ||...|..: |:..|.:.        ..
  Fly   173 LRP---------QDVPKENEHIPNSESDSDRWLPNP-TSTHRPIVTLPTLAPPNL--------KD 219

  Fly   242 REPVFVPVIDSTTTQRTSVPRFSSALPRDDGSDRVIDDYLKQVNLSASEIENSNGEVVKTIVDKN 306
            .||::|||.:.|:|:|:||| ..:..|:.||:|..|||:|.:|:|:.::|:..:|:||.|||||.
  Fly   220 TEPIWVPVPEPTSTERSSVP-LPTLAPKGDGTDSTIDDFLAKVDLTVADIKEEDGQVVTTIVDKQ 283

  Fly   307 GRILTARFVLSSVKGTNEGSQ 327
            ||:|:|.|.||     ||..|
  Fly   284 GRVLSASFALS-----NENEQ 299



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450358
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0020227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.