DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha5 and Htr3b

DIOPT Version :9

Sequence 1:NP_001356885.1 Gene:nAChRalpha5 / 34826 FlyBaseID:FBgn0028875 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_071525.1 Gene:Htr3b / 58963 RGDID:61820 Length:437 Species:Rattus norvegicus


Alignment Length:377 Identity:100/377 - (26%)
Similarity:174/377 - (46%) Gaps:51/377 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 RLLHDLLDPYNTLERPVLNESDPLQLSFGLTLMQIIDVDEKNQLLVTNVWLKLEWNDMNLRWNTS 379
            ||...||..|:...|||.|.::...:...|.:..::|||.:||.|.|::|.:..|||..|.||:|
  Rat    30 RLTRQLLQQYHKEVRPVYNWAEATTVYLDLCVHAVLDVDVQNQKLKTSMWYREVWNDEFLSWNSS 94

  Fly   380 DYGGVKDLRIPPHRIWKPDVLM--YNSADEGFDGTYQTNVVVRNNGSCLYVPPGIFKSTCKIDIT 442
            .:..::::.:|...||.||:::  :...:...|..|   |.|.::|:.....|....|.|.:...
  Rat    95 LFDDIQEISLPLSAIWAPDIIINEFVDVERSPDLPY---VYVNSSGTIRNHKPIQVVSACSLQTY 156

  Fly   443 WFPFDDQRCEMKFGSWTYDGFQLD---LQLQDETGGDISSYVLNGEWELLGVPGKRNEIYY--NC 502
            .||||.|.|.:.|.|..:....:|   |:.|::...|..|::.:.||:||.|    ...|:  ..
  Rat   157 AFPFDIQNCSLTFNSILHTVEDIDLGFLRNQEDIENDKRSFLNDSEWQLLSV----TSTYHIRQS 217

  Fly   503 CPEPYIDITFAIIIRRRTLYYFFNLIIPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLN 567
            ....:..|.|.::|||..|.|..:|:||.:.:..:.|..|.|||:...::.....:|:..|||..
  Rat   218 SAGDFAQIRFNVVIRRCPLAYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTNVLVGYTVFRV 282

  Fly   568 MVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNADTHEMSEWIRIVFLCWLPWI 632
            .:::.:|.::....|:|.:|...|.::..|:..:||::.:.:..                     
  Rat   283 NMSDEVPRSAGCTSLIGVFFTVCMALLVLSLSKSILLIKFLYEE--------------------- 326

  Fly   633 LRMSRPGRPLIL-----------EFPTTPCS-DTSS--ERKHQILSDVELKE 670
             |.|...|||:.           .:...||: ||.|  .::||:.||. ||:
  Rat   327 -RHSEQERPLMCLRGDSDANESRLYLRAPCAEDTESPVRQEHQVPSDT-LKD 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha5NP_001356885.1 LIC 313..802 CDD:273305 100/377 (27%)
Htr3bNP_071525.1 LIC 30..431 CDD:273305 100/377 (27%)
Neur_chan_LBD 30..233 CDD:280998 60/209 (29%)
Neur_chan_memb 242..>313 CDD:280999 17/70 (24%)
HA-stretch 377..409 100/377 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.