DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha5 and ZACN

DIOPT Version :9

Sequence 1:NP_001356885.1 Gene:nAChRalpha5 / 34826 FlyBaseID:FBgn0028875 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_851321.2 Gene:ZACN / 353174 HGNCID:29504 Length:412 Species:Homo sapiens


Alignment Length:389 Identity:81/389 - (20%)
Similarity:148/389 - (38%) Gaps:98/389 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 LIYLNLSAKVCLAGYHEKRLLHDLLDPYNTLERPVLNESDPLQLSFGLTLMQIIDVDEKNQLLVT 361
            |..:|||.||                 ..:::.| .|.|.||.:...:.:..:.:||.....:.:
Human    37 LFNVNLSKKV-----------------QESIQIP-NNGSAPLLVDVRVFVSNVFNVDILRYTMSS 83

  Fly   362 NVWLKLEWNDMNLRWNTSDYGGVKDLRIPPHRIWKP-----DVLMYNSADEG------FDGTYQT 415
            .:.|:|.|.|..|.||||.:.. ..:.:|...:|.|     :.|..:..|:.      .||..:.
Human    84 MLLLRLSWLDTRLAWNTSAHPR-HAITLPWESLWTPRLTILEALWVDWRDQSPQARVDQDGHVKL 147

  Fly   416 NVVVRNNGSCLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQLQDETGGDISSY 480
            |:.:..            ::.|..::..||.|...|.:.|.:.:....:|:.|          ::
Human   148 NLALAT------------ETNCNFELLHFPRDHSNCSLSFYALSNTAMELEFQ----------AH 190

  Fly   481 VLNGEWELLGVPGKRNEIYYNC---CPEPYIDITFAIIIRRR--TLYYFFNLIIPCVLIASMALL 540
            |:|   |::.|  ||..:.|:.   .|...:...|.:.:|.:  .|.....|::|...:....:.
Human   191 VVN---EIVSV--KREYVVYDLKTQVPPQQLVPCFQVTLRLKNTALKSIIALLVPAEALLLADVC 250

  Fly   541 GFTLPPDSGEKLSLGVTILLSLTVFLNMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILIL 605
            |..||..:.|::...||:|||..|..:.:.:.:|::|...|||..||..::.::..|.:.|:|:.
Human   251 GGLLPLRAIERIGYKVTLLLSYLVLHSSLVQALPSSSSCNPLLIYYFTILLLLLFLSTIETVLLA 315

  Fly   606 NY---------------------HHRNADTHEMSE-----------W----IRIVFLCWLPWIL 633
            ..                     .|.|...|...|           |    .||.||.::..:|
Human   316 GLLARGNLGAKSGPSPAPRGEQREHGNPGPHPAEEPSRGVKGSQRSWPETADRIFFLVYVVGVL 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha5NP_001356885.1 LIC 313..802 CDD:273305 75/373 (20%)
ZACNNP_851321.2 LIC 11..368 CDD:273305 76/376 (20%)
Neur_chan_LBD 54..>187 CDD:280998 30/145 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..360 4/31 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.