DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha5 and CG6927

DIOPT Version :9

Sequence 1:NP_001356885.1 Gene:nAChRalpha5 / 34826 FlyBaseID:FBgn0028875 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_572194.1 Gene:CG6927 / 31419 FlyBaseID:FBgn0029733 Length:524 Species:Drosophila melanogaster


Alignment Length:442 Identity:91/442 - (20%)
Similarity:163/442 - (36%) Gaps:112/442 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 RLLHDLLDPYNTLERPVLNESDPLQLSFGLTL------MQIIDVDEKNQLLVTNVWLKLEWNDMN 373
            ||.|..  .|:.||||:.......:|...:.:      ||.::..:    |...::..|:...::
  Fly    42 RLTHGC--RYDRLERPITYSETGQRLPVDVYMRAYIYFMQNLEAHD----LQFKIYALLQMRYLD 100

  Fly   374 LRWNTSDYG--------GVKDLRIPPHRIWKPDVLMYNSADEGFDGTYQTNVVVRNNGSCLYVPP 430
            .|.|..:..        |.:.||   :.:|.|.:.:.|..|....|..:.:::...:.....:..
  Fly   101 PRLNFRNVSPKRRQPILGEEHLR---NSLWMPHIFLANERDSSILGLTEKDILTSISPDGTVIVS 162

  Fly   431 GIFKST--CKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQLQDE-----TGG-DISSYVLNGEW- 486
            ...|:|  |.:::..||||:|.|.....||.|:..:|.|..:.:     .|. .::.:||...| 
  Fly   163 NRIKATLYCWLNLKKFPFDEQHCSTVLESWMYNTSELVLHWEQKRPITYDGALHLTEFVLQRSWS 227

  Fly   487 -ELLGVPGKRNEIYYNCCPEPYIDITFAIIIRRRTLYYFFNLIIPCVLIASMALLGFTLPPDSG- 549
             |.: :....:::.:......|..::|.:.:.|...:|..:..:|.:||.:::.:.|.|..|.. 
  Fly   228 NETV-INADLSDLRHGAFAGNYSSLSFTVHLTRVVGFYLMDYFLPSMLIVAISWVSFWLQADQAP 291

  Fly   550 EKLSLGVTILLSLTVFLNMVAETMPATS----DAVPLLGTYFNCIMFMVASSV----VSTILILN 606
            .:::||.:.||:.....:...:|:|..|    ..|..||    |.:|:..|.|    |:||    
  Fly   292 PRITLGTSTLLTFITLASAQGKTLPKVSYIKVSEVWFLG----CTIFIFGSMVEFAFVNTI---- 348

  Fly   607 YHHRNADTHEMSEWIRIVFLCWLPWILRMSRPGRPLILEFPTTPCSDTSSERKHQILSDVELKER 671
                                    |..:.|.|.:.|              ..||      .||..
  Fly   349 ------------------------WRRKKSVPVKKL--------------NSKH------ILKST 369

  Fly   672 SSKSLLANVLDIDDDFRHNCRPMTPGGTLPHNPAFYRTVYGQGDDGSIGPIG 723
            .|.:||..        |.:.|..:..||..|..|         |.||:|..|
  Fly   370 LSPNLLRR--------RSHARSRSFSGTALHKTA---------DTGSLGGAG 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha5NP_001356885.1 LIC 313..802 CDD:273305 91/442 (21%)
CG6927NP_572194.1 LIC 3..520 CDD:273305 91/442 (21%)
Neur_chan_LBD 36..259 CDD:280998 44/226 (19%)
Neur_chan_memb 270..518 CDD:280999 45/204 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447259
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.