DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha5 and lgc-20

DIOPT Version :9

Sequence 1:NP_001356885.1 Gene:nAChRalpha5 / 34826 FlyBaseID:FBgn0028875 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_496423.1 Gene:lgc-20 / 174733 WormBaseID:WBGene00007191 Length:454 Species:Caenorhabditis elegans


Alignment Length:272 Identity:55/272 - (20%)
Similarity:100/272 - (36%) Gaps:77/272 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 ISYLGSFAAQLRSSSSS-------SSNSSNSGNSSSTQILNGLNKHSWIFLLIYLNLSAKVCLAG 310
            :|:|..|.|.|...:|.       :.|.:|..        :|.::|    .|.|..|:.:     
 Worm     1 MSFLVLFGALLLIQTSEQMVQCRYTKNLTNRA--------DGGDEH----CLFYYLLNKE----- 48

  Fly   311 YHEKRLLHDL-LDPYNTLERPVLNESDPLQLSFGLTLMQIIDVDEKNQLLVTNVW--LKLEWNDM 372
            |.:...:|.| ..|.|         ||.:.::....|::.::: .|......||:  :.|.|.|.
 Worm    49 YEKSGSVHSLSAYPPN---------SDEMTITIENVLVKYVEL-VKGSSYQFNVFGDIYLNWKDE 103

  Fly   373 NLRWN-TSDYGGVKDLRI-PPHRIWKPDVLMYNSADEG------------FDGTYQTNVVVRNNG 423
            .::|: ..::...:.|.| ....||.|.|:.:....||            .|||....:..:   
 Worm   104 RMKWDKKGEFENYEHLYIFNSSAIWTPHVIDHTLCSEGGCSYSVDDVDIYDDGTIYARIQFK--- 165

  Fly   424 SCLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQLQDETGGDISSYVLNG-EWE 487
                     :.::|.:|...||.:|..|.:.|.::             |...:.::.||.| |.|
 Worm   166 ---------YLASCTVDYRKFPEEDDSCCIFFTAF-------------EPNVEQTTLVLEGKEKE 208

  Fly   488 LLGVPGKRNEIY 499
            .:..|....:||
 Worm   209 KMNRPVYAQKIY 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha5NP_001356885.1 LIC 313..802 CDD:273305 41/205 (20%)
lgc-20NP_496423.1 LGIC_ECD 68..>206 CDD:355788 30/163 (18%)
Cys-loop 170..184 CDD:349787 5/13 (38%)
DUF2070 274..>365 CDD:391572
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.