DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha5 and CHRNB4

DIOPT Version :9

Sequence 1:NP_001356885.1 Gene:nAChRalpha5 / 34826 FlyBaseID:FBgn0028875 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_000741.1 Gene:CHRNB4 / 1143 HGNCID:1964 Length:498 Species:Homo sapiens


Alignment Length:516 Identity:196/516 - (37%)
Similarity:289/516 - (56%) Gaps:54/516 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 CLAGYHEKRLLHDLLDP--YNTLERPVLNESDPLQLSFGLTLMQIIDVDEKNQLLVTNVWLKLEW 369
            |.....|::|:.|||:.  ||.|.||..:.|..:.:...|:|.|:|.|:|:.|::.||||||.||
Human    21 CRVANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIKLQLSLAQLISVNEREQIMTTNVWLKQEW 85

  Fly   370 NDMNLRWNTSDYGGVKDLRIPPHRIWKPDVLMYNSADEGFDGTYQTNVVVRNNGSCLYVPPGIFK 434
            .|..|.||:|.|.||..||||..|||.||:::||:||..::.:..||::||:|||.|::||.|:|
Human    86 TDYRLTWNSSRYEGVNILRIPAKRIWLPDIVLYNNADGTYEVSVYTNLIVRSNGSVLWLPPAIYK 150

  Fly   435 STCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQLQDETGGDISSYVLNGEWELLGVPGKRNEIY 499
            |.|||::.:||||.|.|.:||.|||||..::|:.|...| ..:..:..:|||:::.:||:|.   
Human   151 SACKIEVKYFPFDQQNCTLKFRSWTYDHTEIDMVLMTPT-ASMDDFTPSGEWDIVALPGRRT--- 211

  Fly   500 YNCCPEPYIDITFAIIIRRRTLYYFFNLIIPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTV 564
            .|.....|:|:|:..||:|:.|:|..||||||||...:|:|.|.||.|.|||::|.:::||:||.
Human   212 VNPQDPSYVDVTYDFIIKRKPLFYTINLIIPCVLTTLLAILVFYLPSDCGEKMTLCISVLLALTF 276

  Fly   565 FLNMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNADTHEMSEWIRIVFLCWL 629
            ||.::::.:|.||..|||:|.|....|.:|..|:|:::.:||.|||:..||.|:.|::..||..|
Human   277 FLLLISKIVPPTSLDVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHTMAPWVKRCFLHKL 341

  Fly   630 PWILRMSRPGRPLILEFPTTPCSDTSSERKHQILSDVELKERSSKSLLANVLDIDDDFRHNCRP- 693
            |..|.|.|||            .|:|..|...          .|||.:.             :| 
Human   342 PTFLFMKRPG------------PDSSPARAFP----------PSKSCVT-------------KPE 371

  Fly   694 MTPGGTLPHNPAFY-RTVY--GQGDDGSIGPIGSTRMPDAVTHHTCIKSSTEY--ELGLILKEIR 753
            .|...|.|.|  || .::|  ......|..|.|||  |.|:.....::||..:  ::...|:.:.
Human   372 ATATSTSPSN--FYGNSMYFVNPASAASKSPAGST--PVAIPRDFWLRSSGRFRQDVQEALEGVS 432

  Fly   754 FITDQLRKDDECNDIANDWKFAAMVVDRLCLIIFTMFTILATIAVLLS---APHIIVSXPY 811
            ||...::.|||...:..|||:.|||||||.|.:|....:|.|:.:.|.   ..|.... ||
Human   433 FIAQHMKNDDEDQSVVEDWKYVAMVVDRLFLWVFMFVCVLGTVGLFLPPLFQTHAASEGPY 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha5NP_001356885.1 LIC 313..802 CDD:273305 192/499 (38%)
CHRNB4NP_000741.1 Neur_chan_LBD 5..480 CDD:332142 192/501 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 357..377 6/42 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.