DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha5 and si:ch211-256e16.4

DIOPT Version :9

Sequence 1:NP_001356885.1 Gene:nAChRalpha5 / 34826 FlyBaseID:FBgn0028875 Length:837 Species:Drosophila melanogaster
Sequence 2:XP_017210328.1 Gene:si:ch211-256e16.4 / 100333796 ZFINID:ZDB-GENE-131121-267 Length:179 Species:Danio rerio


Alignment Length:296 Identity:63/296 - (21%)
Similarity:101/296 - (34%) Gaps:130/296 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   507 YID-ITFAIIIRRRTLYYFFNLIIPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLNMVA 570
            |.| :.:.|.|:||.|.:..|:|:|......:.:..:.:..|..:|||..||:||:::|.|.::.
Zfish     4 YADQLIYQITIKRRPLLHVINIILPVFFFLVLDVTSYFIDTDGADKLSFKVTLLLAISVLLLILN 68

  Fly   571 ETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNADTHEMSEWIRIVFLCWLPWILRM 635
            :|:|:|:..:||:|.|.:.|..::..|::.|||: |:                            
Zfish    69 DTLPSTTYELPLIGIYCSAIFSLIGISILETILV-NF---------------------------- 104

  Fly   636 SRPGRPLILEFPTTPCSDTSSERKHQILSDVELKERSSKSLLANVLDIDDDFRHNCRPMTPGGTL 700
                                            |:.:.:|.|.|:.                    
Zfish   105 --------------------------------LRAKGAKILSASA-------------------- 117

  Fly   701 PHNPAFYRTVYGQGDDGSIGPIGSTRMPDAVTHHTCIKSSTEYELGLILKEIRFITDQLRKDDEC 765
                    .|.|| |||..||      |                           .||.|...|.
Zfish   118 --------AVTGQ-DDGVSGP------P---------------------------VDQDRDQKEF 140

  Fly   766 NDIANDWKFAAMVVDRLCLIIFTMFTILATIAVLLS 801
             .||..|...|.:.|.:.||::     |.||.|.||
Zfish   141 -QIAMWWIKVARITDMMFLILY-----LLTIVVFLS 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha5NP_001356885.1 LIC 313..802 CDD:273305 63/296 (21%)
si:ch211-256e16.4XP_017210328.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.