DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and SCARF2

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_699165.3 Gene:SCARF2 / 91179 HGNCID:19869 Length:871 Species:Homo sapiens


Alignment Length:309 Identity:79/309 - (25%)
Similarity:99/309 - (32%) Gaps:103/309 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 CCPGYLQVESGLCEPICSRGCPAHASCAAPDR-CECISGYVSARNHQ-DGSHYCEP-----ICET 134
            |.....:.:||.|:      |......|..|| |:|..|    |.|. ||:..|||     .|..
Human   217 CNSSPCEQQSGRCQ------CRERTFGARCDRYCQCFRG----RCHPVDGTCACEPGYRGKYCRE 271

  Fly   135 PCPAG----------AQCVTPNTC--------ACRDGYTQL---QPTDDGVSG-GCA---PVCRV 174
            |||||          .||.....|        .|..|:...   ||...|..| ||:   |.||.
Human   272 PCPAGFYGLGCRRRCGQCKGQQPCTVAEGRCLTCEPGWNGTKCDQPCATGFYGEGCSHRCPPCRD 336

  Fly   175 GDGC--ANGKCIDVDRCACNSGYRWDKAEERCIELSAESISEELETTEDNTDSPSTSSTAVFTAT 237
            |..|  ..|||     ..||:|:..|:.|.:|   |..:..|:                ..|...
Human   337 GHACNHVTGKC-----TRCNAGWIGDRCETKC---SNGTYGED----------------CAFVCA 377

  Fly   238 HCPDDFVLFRGECREKQFDSNDVGCLKSGCGPHQTCLDSGVCQ--CSDGYVPEESGEATGVLSCR 300
            .|..      |.|   .|.|....|.....|||        |.  |..|....:..:|   .||.
Human   378 DCGS------GHC---DFQSGRCLCSPGVHGPH--------CNVTCPPGLHGADCAQA---CSCH 422

  Fly   301 RTLLDQILGLNEAIDDDDELNPWTIPIIGV-ACGFLFVLLI---VGLLG 345
            ....|.:.|......:..:         || ..|.|.|||:   :.|||
Human   423 EDTCDPVTGACHLETNQRK---------GVMGAGALLVLLVCLLLSLLG 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC4NP_609698.2 None
SCARF2NP_699165.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
PHA03247 <534..871 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 570..871
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.