DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and SCARF1

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_003684.2 Gene:SCARF1 / 8578 HGNCID:16820 Length:830 Species:Homo sapiens


Alignment Length:325 Identity:85/325 - (26%)
Similarity:107/325 - (32%) Gaps:116/325 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 EQVTHRLVRECCPGYLQVESGLCEPICSRGCPAHAS--------CA------APD---RCECISG 114
            ||.|...|  |.||:....       ||..|..|.|        ||      .|:   :|||:.|
Human   173 EQATGACV--CKPGWWGRR-------CSFRCNCHGSPCEQDSGRCACRPGWWGPECQQQCECVRG 228

  Fly   115 YVSARNHQDGSHYCEP-----ICETPCPAGA---QCV------------TPNT--C-ACRDGY-- 154
            ..||.:   |...|.|     .||.|||||:   ||.            :|:|  | :|..|:  
Human   229 RCSAAS---GECTCPPGFRGARCELPCPAGSHGVQCAHSCGRCKHNEPCSPDTGSCESCEPGWNG 290

  Fly   155 TQL-QPTDDGVSG-GC---APVCRVGDGCANGKCIDVDRC-ACNSGYRWDKAEERCIELSAESIS 213
            ||. ||...|..| .|   .|.||.|:.|..    |...| .|:.|:...:.|:.|         
Human   291 TQCQQPCLPGTFGESCEQQCPHCRHGEACEP----DTGHCQRCDPGWLGPRCEDPC--------- 342

  Fly   214 EELETTEDNTDSPSTSSTAVFTATHCPDDFVLFRGECREKQFDSNDVGCLKSGCGPH-------- 270
               .|.....|..||..|.|             :|.|   ...:.|..|.....||.        
Human   343 ---PTGTFGEDCGSTCPTCV-------------QGSC---DTVTGDCVCSAGYWGPSCNASCPAG 388

  Fly   271 ---QTCLDSGVCQCSDGYVPEESGEATGVLSCRRTLLDQILGLNEAIDDDDELNPWTIPIIGVAC 332
               ..|  |..|:|.:|.....||........|.|.|  |.|         .|.|..:..:|:||
Human   389 FHGNNC--SVPCECPEGLCHPVSGSCQPGSGSRDTAL--IAG---------SLVPLLLLFLGLAC 440

  Fly   333  332
            Human   441  440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC4NP_609698.2 None
SCARF1NP_003684.2 CSRNP_N <100..135 CDD:292638
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 516..539
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 581..688
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 715..830
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.