DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and MEGF10

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_016865476.1 Gene:MEGF10 / 84466 HGNCID:29634 Length:1195 Species:Homo sapiens


Alignment Length:338 Identity:84/338 - (24%)
Similarity:116/338 - (34%) Gaps:82/338 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 NAERDNYCERNE----TIRATVPVTKQRIIVKQPSKWKIWKKTEKITEIYDS---EEEQVTHRLV 74
            |.|..|.|...|    |::.:.|....:|.....:....|.|..:....|.:   ..|:..:|..
Human    82 NLEDPNVCSHWESYSVTVQESYPHPFDQIYYTSCTDILNWFKCTRHRVSYRTAYRHGEKTMYRRK 146

  Fly    75 RECCPGYLQVESG-LCEPICSRGCPAHASCAAPDRCECISGY--VSARNHQDGSHY--------- 127
            .:||||:  .||| :|.|.|:..| .|..|.||:.|:|..|:  .:..:..||.|:         
Human   147 SQCCPGF--YESGEMCVPHCADKC-VHGRCIAPNTCQCEPGWGGTNCSSACDGDHWGPHCTSRCQ 208

  Fly   128 ------CEPI--------------CETPCPAG---------AQCVTPNT-------CACRDGYTQ 156
                  |.||              ||..|..|         .||....|       |.|..|||.
Human   209 CKNGALCNPITGACHCAAGFRGWRCEDRCEQGTYGNDCHQRCQCQNGATCDHVTGECRCPPGYTG 273

  Fly   157 LQPTDDGVSGGCAPVCRVGDGCAN-GKCIDV-DRCACNSGYRWDKAEERCIE-LSAESISEELET 218
            ....|....|...|.|.....|.| |.|..| ..|:|.||:......:.|.| ...::.|:|.:.
Human   274 AFCEDLCPPGKHGPQCEQRCPCQNGGVCHHVTGECSCPSGWMGTVCGQPCPEGRFGKNCSQECQC 338

  Fly   219 TEDNTDSPSTSSTAVFTATHCPDDFVLFRGE-CREKQFDSNDVGCLKSGCGPHQTCLD------- 275
            ....|...:|..      .||...:.   || |:    |...||.....|.....|::       
Human   339 HNGGTCDAATGQ------CHCSPGYT---GERCQ----DECPVGTYGVLCAETCQCVNGGKCYHV 390

  Fly   276 SGVCQCSDGYVPE 288
            ||.|.|..|:..|
Human   391 SGACLCEAGFAGE 403



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.