DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and MEGF11

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001371957.1 Gene:MEGF11 / 84465 HGNCID:29635 Length:1140 Species:Homo sapiens


Alignment Length:382 Identity:82/382 - (21%)
Similarity:115/382 - (30%) Gaps:154/382 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ALILVLGSIAANAERDNYCERNETIRATVPVTK----QRIIVKQPSKWKIWKKTEKITEIYDSEE 66
            |...:..::|.|.|..|.|...|:...||..:.    .:|...:.:....|.|..:....|.:..
Human    10 AFSFLQATLALNPEDPNVCSHWESYAVTVQESYAHPFDQIYYTRCTDILNWFKCTRHRISYKTAY 74

  Fly    67 EQVTHRLVR---ECCPGYLQVESG-LCEPICSRGCPAHASCAAPDRCECISGY--VSARNHQDGS 125
            .:....:.|   :|||||  .||| .|.|:|:..| .|..|.:||.|.|..|:  ....:..|..
Human    75 RRGLRTMYRRRSQCCPGY--YESGDFCIPLCTEEC-VHGRCVSPDTCHCEPGWGGPDCSSGCDSD 136

  Fly   126 HY---------------CEPI---------------------------CETPCPA--GAQCVTPN 146
            |:               |.||                           |:.||..  ||.| .|.
Human   137 HWGPHCSNRCQCQNGALCNPITGACVCAAGFRGWRCEELCAPGTHGKGCQLPCQCRHGASC-DPR 200

  Fly   147 T--CACRDGYTQLQ------------------PTDDG-----VSGGCA-------PVC------- 172
            .  |.|..|||.:.                  |..:|     ::|.||       .||       
Human   201 AGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPG 265

  Fly   173 RVGDGCA-------NGKCIDV-DRCACNSGYRWDKAEERCIELSAESISEELETTEDNTDSPSTS 229
            ..|..|:       .|:|..| .:|.|.:||..|:.:|.|                         
Human   266 TFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDRCQEEC------------------------- 305

  Fly   230 STAVFTATHCPDDFVLFRGECREKQFDSNDVGCLKSG-CGPHQTCLDSGVCQCSDGY 285
                        .|..|..:|      |....|...| |.|     .:|.|:|..||
Human   306 ------------PFGSFGFQC------SQHCDCHNGGQCSP-----TTGACECEPGY 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC4NP_609698.2 None
MEGF11NP_001371957.1 EMI 26..93 CDD:400092 15/68 (22%)
EGF_CA 275..320 CDD:419698 14/87 (16%)
EGF_CA 362..409 CDD:419698
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.