DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and Megf11

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_038938374.1 Gene:Megf11 / 691517 RGDID:1582797 Length:1139 Species:Rattus norvegicus


Alignment Length:430 Identity:93/430 - (21%)
Similarity:131/430 - (30%) Gaps:165/430 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LILVLGSIAANAERDNYCERNETIRATVPVTK----QRIIVKQPSKWKIWKKTEKITEIYDSEEE 67
            :.|:..::|.|.|..|.|...|:...||..:.    .:|...:.:....|.|..:....|.:...
  Rat    11 VFLLQAALALNPEDPNVCSHWESYAVTVQESYAHPFDQIYYTRCADILNWFKCTRHRISYKTAYR 75

  Fly    68 QVTHRLVR---ECCPGYLQVESG-LCEPICSRGCPAHASCAAPDRCECISGY--VSARNHQDGSH 126
            :....:.|   :|||||  .|:| .|.|:|:..| .|..|.:||.|.|..|:  ....:..|..|
  Rat    76 RGLRTMYRRRSQCCPGY--YENGDFCIPLCTEEC-MHGRCVSPDTCHCEPGWGGPDCSSGCDSEH 137

  Fly   127 Y---------------CEPI--------------CETPCPAG---------AQC-----VTPNT- 147
            :               |.||              ||..|..|         .||     ..|.| 
  Rat   138 WGPHCSNRCQCQNGALCNPITGACVCAPGFRGWRCEEFCAPGTHGKGCQLLCQCHHGASCDPRTG 202

  Fly   148 -CACRDGYTQLQ------------------PTDDG-----VSGGCA-------PVC-------RV 174
             |.|..|||.:.                  |..:|     ::|.||       .||       ..
  Rat   203 ECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTF 267

  Fly   175 GDGCA-------NGKCIDV-DRCACNSGYRWDKAEERCIELSAESISEELETTEDNTDSPSTSST 231
            |..|:       .|:|..| .:|.|.:||..|:.:|.|                           
  Rat   268 GQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDRCQEEC--------------------------- 305

  Fly   232 AVFTATHCPDDFVLFRGECREKQFDSNDVGCLKSG-CGPHQTCLDSGVCQCSDGYVPEESGEATG 295
                      .|..|...|.::      ..|...| |.|     .:|.|:|..||    .|.   
  Rat   306 ----------PFGTFGFRCSQR------CDCHNGGQCSP-----ATGACECEPGY----KGP--- 342

  Fly   296 VLSCRRTLLDQIL---GLNEAIDDDDELNPWTIPIIGVAC 332
              ||:..|..:.|   |.......|.|......|:.| ||
  Rat   343 --SCQERLCPEGLHGPGCTSPCPCDTENTISCHPVTG-AC 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC4NP_609698.2 None
Megf11XP_038938374.1 EMI 26..93 CDD:400092 15/68 (22%)
EGF_CA 189..234 CDD:419698 9/44 (20%)
Laminin_EGF 275..320 CDD:395007 13/87 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.