DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and Megf6

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_075244.1 Gene:Megf6 / 65049 RGDID:621188 Length:1574 Species:Rattus norvegicus


Alignment Length:468 Identity:108/468 - (23%)
Similarity:155/468 - (33%) Gaps:163/468 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IWKKT-----------EKITEIYDSEEE--QVTHRLVRECCPGYLQ---------------VESG 87
            :|::|           |:.|..|.|..:  ....|.|..||||:.|               ..:|
  Rat    68 VWRRTGCAQQAWCIGQERRTVYYMSYRQVYATEARTVFRCCPGWSQKPGQEGCLSDVDECASANG 132

  Fly    88 LCE-PICSR------GCPA-------HASCAAPDRCECISGYVSAR-NHQDGSHYCEPICE---- 133
            .|| |.|:.      .||.       ..:|...|.|...:|....| .:..||:.||  |:    
  Rat   133 GCEGPCCNTVGGFYCRCPPGYQLQGDGKTCQDVDECRAHNGGCQHRCVNTPGSYLCE--CKPGFR 195

  Fly   134 -----------TPCPAG-----AQC----VTPNTCACRDGYTQLQ----------PTDDGVSGGC 168
                       :.|..|     .||    ||.:.|.||..| |||          |..:| :|||
  Rat   196 LHTDGRTCLAISSCTLGNGGCQHQCVQLTVTQHRCQCRPQY-QLQEDGRRCVRRSPCAEG-NGGC 258

  Fly   169 APVCR-----VGDGCANG--------KCIDVDRCA--------------------CNSGYRWDKA 200
            ..:|:     ...||..|        .|.|||.||                    |::||.....
  Rat   259 MHICQELRGLAHCGCHPGYQLAADRKTCEDVDECALGLAQCAHGCLNTQGSFKCVCHAGYELGAD 323

  Fly   201 EERCIELSAESISEELETTEDNTD--SPSTSSTAVFTATHCPDDFVLFRGECREKQFDSNDVGCL 263
            ..:|..:..|.::    :.|....  |...|.|:......||..:.|  .|.::...|.:|  |.
  Rat   324 GRQCYRIEMEIVN----SCEAGNGGCSHGCSHTSTGPLCTCPRGYEL--DEDQKTCIDIDD--CA 380

  Fly   264 KSGCGPHQTCLDS-GVCQCS---------DGYVPEESGE-ATGVLSCRRTL-------------- 303
            .|.| ..|.|.:: |..:||         ||...|:..| |:|...|....              
  Rat   381 NSPC-CQQACANTPGGYECSCFAGYRLNTDGCGCEDVDECASGHGGCEHHCSNLAGSFQCFCEAG 444

  Fly   304 --LDQ----ILGLNEAIDDDDELNPWTIPIIGVACGFLFVLL--IVGLLGGRRYRQERAALANKE 360
              ||:    ...|.|::.|.|...|:..|:..:|     ||.  :..|.......:|.||.|...
  Rat   445 YRLDEDRRGCTSLEESVVDLDGRLPFVRPLPHIA-----VLRDELPRLFQDDYGAEEEAAAAELR 504

  Fly   361 MECQYSQKTVDVD 373
            .|...::|.|.:|
  Rat   505 GEHTLTEKFVCLD 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC4NP_609698.2 None
Megf6NP_075244.1 EMI 42..112 CDD:284877 12/43 (28%)
FXa_inhibition 127..162 CDD:291342 7/34 (21%)
vWFA <154..202 CDD:294047 10/49 (20%)
vWFA <237..285 CDD:294047 12/48 (25%)
vWFA <284..325 CDD:294047 9/40 (23%)
FXa_inhibition 338..373 CDD:291342 8/36 (22%)
vWFA <371..410 CDD:294047 10/41 (24%)
vWFA <413..452 CDD:294047 7/38 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1555..1574
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.