DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and pear1

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_700533.4 Gene:pear1 / 571812 ZFINID:ZDB-GENE-091230-1 Length:1020 Species:Danio rerio


Alignment Length:362 Identity:87/362 - (24%)
Similarity:116/362 - (32%) Gaps:114/362 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IWALILVLG-----SIAANAERDNYCERNETIRATVPVTKQRIIVKQP----------SKWKIWK 53
            |..::.|||     |::.:....|.|...|:...:|..:     ..||          ..|...|
Zfish     6 ICVVLFVLGCVCELSLSLDPRDPNVCSLWESFTTSVKES-----YAQPFDQMSEEPCSEPWSANK 65

  Fly    54 KT-EKITEIYDSEEEQVT---HRLVRECCPGYLQVESGLCEPICSRGCPAHASCAAPDRCECISG 114
            .| .:||  |.:...||.   :|...:||||:.: ....|.|.|::.| .|..|.|||||:|..|
Zfish    66 CTRHRIT--YKTLYRQVVKMDYRRRYQCCPGFYE-SRNKCVPRCTKEC-VHGRCVAPDRCQCEMG 126

  Fly   115 Y--VSARNHQDGSHY---CEPICETPCPAGAQC-VTPNTCACRDGYTQLQPTD----DGVSGGCA 169
            :  ....:..||.|:   |..:||  |..|.:| |....|.|..|||.....|    .....||.
Zfish   127 WRGDDCSSSCDGQHWGPGCRRLCE--CQNGGECDVLTGNCQCPAGYTGQHCHDPCPVKWFGQGCR 189

  Fly   170 PVCRVGDGCANGKCID-VDRCACNSGYRWDKAEERCIELSAESISEELETTEDNTDSPSTSSTAV 233
            ..|:.|.|   |.|.. ...|.|..|:.....||.|                     |....   
Zfish   190 QECQCGTG---GICNQTTGECVCKQGFTGTLCEESC---------------------PRPKR--- 227

  Fly   234 FTATHCPDDFVLFRGECREKQFDSNDVGCL-----------------KSGCGPHQTCL------- 274
             .|..||         |:.......:..||                 :.|....:.||       
Zfish   228 -CAARCP---------CQNGGICQGNGVCLCPPGWMGPVCTERCPPGRFGINCSKDCLCHNGGHC 282

  Fly   275 --DSGVCQCSDGYVPEESGE----------ATGVLSC 299
              :.|.|||..||..|...|          ..||..|
Zfish   283 DQEKGQCQCDAGYTGERCNEECPVGTYGEDCKGVCDC 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC4NP_609698.2 None
pear1XP_700533.4 EMI 29..96 CDD:284877 19/73 (26%)
Laminin_EGF 411..451 CDD:278482
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.