DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and stab2

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_017210540.1 Gene:stab2 / 565194 ZFINID:ZDB-GENE-041210-336 Length:2543 Species:Danio rerio


Alignment Length:334 Identity:78/334 - (23%)
Similarity:106/334 - (31%) Gaps:142/334 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 ECCPGYLQVESGLCEPICSRG----CPAHASCA-----------------------------APD 107
            :||.|:...:   |.| |..|    |.:|.:|:                             .|:
Zfish   718 QCCKGFFGPD---CSP-CPGGFTTPCSSHGTCSEGIDGNGTCQCEPKFKGSRCQYCADSNKYGPN 778

  Fly   108 ---RCECISGYVSARNHQDGSHYCE----------PICE---------TPCPAGAQCVTPN---T 147
               .|.||.|  :..||.:.|..|:          ..||         .||.|.|.||:..   |
Zfish   779 CDKTCWCIHG--TCDNHPEASGKCKQGSCKDGYTGEYCELQTQPCGPNQPCHAHANCVSNKGAFT 841

  Fly   148 CACRDGYTQLQPTDDGVSGGCAPVCRVGDGCA---------NGKCI----DVDRCACNSGYRWDK 199
            |.|:.|:     ..||.      :|...|.||         |..||    ...:|.|.||:|.|.
Zfish   842 CVCKPGF-----QGDGY------MCMESDPCALPHRGGCSKNAICIKTGPGTHKCKCLSGWREDG 895

  Fly   200 AEERCIELSAESISEELETTEDNTDSPSTSSTAVFTATHC-PDDFVLFRG----ECREKQ-FDSN 258
            .|.:.|               :|...||...        | |:...::.|    :|..|. :..|
Zfish   896 DECQAI---------------NNCLDPSRGG--------CHPNATCIYVGPGQIDCACKSGYHGN 937

  Fly   259 DVGC--------LKSGCGPHQTCL----DSGVCQCSDGYVPEESGEATGVLSCRRTLLDQI---- 307
            ...|        .|.||....||.    |...|.|.|||    :|:..   .|..|||.::    
Zfish   938 GRECEPVNQCVEQKGGCHFLATCQFLNPDGWHCVCEDGY----AGDGK---ICYGTLLQEVSTNP 995

  Fly   308 --LGLNEAI 314
              ||.|:.|
Zfish   996 DLLGFNQWI 1004

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC4NP_609698.2 None
stab2XP_017210540.1 EGF_3 239..268 CDD:289699
Fasciclin 374..495 CDD:280607
Fasciclin 518..643 CDD:280607
EGF_3 824..855 CDD:289699 12/41 (29%)
EGF_3 910..941 CDD:289699 6/38 (16%)
Fasciclin 1000..1119 CDD:280607 2/5 (40%)
Fasciclin 1135..1252 CDD:280607
EGF_3 1465..1501 CDD:289699
EGF_3 1550..1586 CDD:289699
Fasciclin 1616..1716 CDD:280607
Fasciclin 1742..1873 CDD:280607
EGF_3 2076..2111 CDD:289699
EGF_3 2117..2154 CDD:289699
Link_Domain 2188..2280 CDD:295393
FAS1 2345..2438 CDD:214719
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.