DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and megf11

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_009291879.1 Gene:megf11 / 563468 ZFINID:ZDB-GENE-060503-252 Length:1114 Species:Danio rerio


Alignment Length:306 Identity:87/306 - (28%)
Similarity:116/306 - (37%) Gaps:51/306 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVLGSIAANAERDNYCERNETIRATVPVTK----QRIIVKQPSKWKIWKKTEKITEIYDSEEEQV 69
            |::.:.:.|.:..|.|...|:...||..:.    .:|...:.:....|.|..:....|.:...:.
Zfish    19 LIISAWSLNPDDPNVCSHWESYAVTVQESYAHPFDQIYYTRCTDILNWFKCTRHRTSYKTAYRRG 83

  Fly    70 THRLVR---ECCPGYLQVESG-LCEPICSRGCPAHASCAAPDRCECISGYVSARNHQDGSHYCE- 129
            ...:.|   :|||||.  ||| ||.|.||..| ||..|.:||.|:|..|:    ...|.|..|| 
Zfish    84 VRTMYRRRSQCCPGYF--ESGDLCVPRCSEEC-AHGRCVSPDTCQCEPGW----GGLDCSSGCES 141

  Fly   130 ----PICETPCPA--GAQCVTPNT--CACRDGYTQLQPTD---DGVSG-GCAPVCRVGDGCANGK 182
                |.|...|..  ||.| .|.|  |.|.|||...:..|   .|..| ||...|:    |.||.
Zfish   142 GYWGPHCSNRCQCKNGALC-NPITGACVCTDGYQGWRCEDLCEPGYYGKGCQLQCQ----CLNGA 201

  Fly   183 CI--DVDRCACNSGYRWDKAEERCIELSAESISEELETTEDNTD----SPSTSSTAVFTATHC-- 239
            ..  :...|.|..||......|||...|.....|:....::...    :...|..|.:|.:.|  
Zfish   202 TCHHETGECICAPGYMGPICGERCPSGSHGPQCEQRCPCQNGGTCHHITGECSCPAGWTGSVCAQ 266

  Fly   240 PDDFVLFRGECREKQFDSNDVGCLKSGCGPHQTCLDSGVCQCSDGY 285
            |..|..:...|      |.:..|...|...|.|    |.|||..||
Zfish   267 PCPFGKYGINC------SKECSCRNGGLCDHIT----GQCQCMAGY 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC4NP_609698.2 None
megf11XP_009291879.1 EMI 32..98 CDD:311482 13/65 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.