DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and ccbe1

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001157395.1 Gene:ccbe1 / 555629 ZFINID:ZDB-GENE-090506-7 Length:401 Species:Danio rerio


Alignment Length:234 Identity:52/234 - (22%)
Similarity:84/234 - (35%) Gaps:66/234 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ATVPVTKQRIIVKQPSKWKIWKKTEKITEIYDSEEE-------------QVTHRLVRECCPGYLQ 83
            |::.|....::....:.|...::.|.:.....||.:             :||....::||.|:..
Zfish     8 ASLSVAVALVLFSSGAPWTFREEKEDVDREVCSESKIATTKYPCVKSTGEVTTCYRKKCCEGFKF 72

  Fly    84 VESGLCEP----ICSRGCPAHASCAAPDR-----CECISGY-VSARNHQDGSH-YCEPI--C--- 132
            | .|.|.|    :|: |.|....|.  |.     |.|..|| .....|::... ||..|  |   
Zfish    73 V-LGQCIPEDYDVCA-GAPCEQQCT--DHFGRVVCTCYDGYRYDRERHRNREKPYCLDIDECANN 133

  Fly   133 -ETPCPAGAQCV-TPNT--CACRDGYTQLQPTDDG---VSGGCAPVCRVGD-----GCANGKCID 185
             ||.|  ...|| ||.:  |.|..|: .|:  |||   ..|..||:....|     |..:..|.|
Zfish   134 NETVC--SQMCVNTPGSYRCDCHSGF-YLE--DDGKTCTKGERAPLFEKSDNVMKEGTCSATCED 193

  Fly   186 VDRCACNSGYRWDKAEERCIELSAESISEELETTEDNTD 224
            ..:                ::::...:.:::.....||:
Zfish   194 FHQ----------------MKMTVLQLKQKMSLLSSNTE 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC4NP_609698.2 None
ccbe1NP_001157395.1 FXa_inhibition 130..166 CDD:291342 15/40 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..321
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..401
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.