DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and Dkk3

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001347186.1 Gene:Dkk3 / 50781 MGIID:1354952 Length:366 Species:Mus musculus


Alignment Length:286 Identity:61/286 - (21%)
Similarity:93/286 - (32%) Gaps:89/286 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LGSIAANAERDNYCER---NETIRATVPVTKQRIIVKQPSKWKIWKKTEKITEIYDSEEEQVTHR 72
            |.|:..|...:...|.   |.|:.....|.|   |....|...::.:| .||.:.| ||.:.:|.
Mouse   104 LASLPPNYHNETSTETRVGNNTVHVHQEVHK---ITNNQSGQVVFSET-VITSVGD-EEGKRSHE 163

  Fly    73 LV--RECCP-GYLQVES--GLCEP------ICSRGCPAHASCAAPDRC---ECISGYVSARNHQ- 122
            .:  .:|.| .|.|..|  ..|:|      :|:|    .:.|.....|   .|........|.. 
Mouse   164 CIIDEDCGPTRYCQFSSFKYTCQPCRDQQMLCTR----DSECCGDQLCAWGHCTQKATKGGNGTI 224

  Fly   123 -DGSHYCE-------------PICETPCPAGAQCVTPNTCACRDGYTQLQPTDDGVSGGCAPVCR 173
             |....|:             |:| ||.|...:       .|.|..:||.   |.::....|   
Mouse   225 CDNQRDCQPGLCCAFQRGLLFPVC-TPLPVEGE-------LCHDPTSQLL---DLITWELEP--- 275

  Fly   174 VGDGCANGKCIDVDRCACNSGYRWDKAEERCIEL------SAESISEELETTEDNTDSPSTSSTA 232
              :|.       :|||.|.||..........:.:      .:...|||.:...:           
Mouse   276 --EGA-------LDRCPCASGLLCQPHSHSLVYMCKPAFVGSHDHSEESQLPRE----------- 320

  Fly   233 VFTATHCPDDF--VLFRGECREKQFD 256
                  .||::  |.|.||.|::..|
Mouse   321 ------APDEYEDVGFIGEVRQELED 340



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.