DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and eater

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_651533.3 Gene:eater / 43262 FlyBaseID:FBgn0243514 Length:1074 Species:Drosophila melanogaster


Alignment Length:303 Identity:86/303 - (28%)
Similarity:130/303 - (42%) Gaps:48/303 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 CCPGYLQVESGLCEPICSRGCPAHASCAAPDRCECISGYVSARNHQDGSHYCEPICETPCPAGAQ 141
            |..||.:.....|:||||:|| .:..|.||::|.|..||     ..|..:.|.|:|...|..|. 
  Fly   810 CDEGYSRETGNSCKPICSKGC-ENGFCDAPEKCSCNDGY-----EMDSENRCSPVCSGGCKNGF- 867

  Fly   142 CVTPNTCACRDGYTQLQPTDDGVSGGCAPVCRVGDGCANGKCIDVDRCACNSGYRWDKAEERCIE 206
            ||.|..|:|.:||::    :..:|  |||.|:  |||.||.|:..|.|.|:.||.:.:..:.|  
  Fly   868 CVAPGKCSCDEGYSK----ETEIS--CAPFCK--DGCVNGLCVSPDFCKCDDGYIFVEESKSC-- 922

  Fly   207 LSAESISEELETTEDNTDSPSTSSTAVFTATHCPDDFVLFRGECREKQFDSNDVGCLKSGCGPHQ 271
                .:.:||.....:.|....:.|.|.....|...:.|.|.|      |.|::.||.. |.|. 
  Fly   923 ----QLDKELLGDYSDCDKNCRNGTCVEGICTCSKQYKLHRNE------DDNNLICLPI-CEPE- 975

  Fly   272 TCLDS-----GVCQCSDGYVPEESGEATGVLSCRRTLLDQILGLNEAIDDDDELNPWTIPIIGVA 331
             ||:.     |.|.|.||..|.:.      .||:.  :|.:..|......:..|....|.|:.:|
  Fly   976 -CLNGLCEFPGSCVCWDGESPIDG------YSCQS--MDSLGSLTGHEKSERHLKWVFITIVSMA 1031

  Fly   332 --CGFLFVLLIVGLLGGRRYRQERAALANKEMECQYSQKTVDV 372
              ...:..:||:.:...|.|..::   ..:|....:|...||:
  Fly  1032 FILAIITTMLIIYIFRKRSYHVDK---NEREFGVYFSPNKVDI 1071



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D97941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.