DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and CG15861

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001286863.1 Gene:CG15861 / 37990 FlyBaseID:FBgn0035084 Length:205 Species:Drosophila melanogaster


Alignment Length:106 Identity:32/106 - (30%)
Similarity:44/106 - (41%) Gaps:17/106 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 YDSEEEQVTHRLVRECCPGYLQVESGLCEPICSRGCPAHASCAAPDRCECISGYVSARNHQDGSH 126
            :|...::..||..|            |.:| |...| .|.:|::..||.|..|| ..|:......
  Fly   115 FDPLSQKCRHRAPR------------LLDP-CLGRC-THGNCSSDGRCICAQGY-ELRDSLLHGQ 164

  Fly   127 YCEPICETPCPAGAQCVTPNTCACRDGYTQLQPTDDGVSGG 167
            .|.|||:..|...|.|..||.||||  :.|.....:|:..|
  Fly   165 QCMPICDHNCGPRAYCFAPNLCACR--HKQHHYAHNGICSG 203



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D97941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.