DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and PEAR1

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_016856723.1 Gene:PEAR1 / 375033 HGNCID:33631 Length:1125 Species:Homo sapiens


Alignment Length:400 Identity:84/400 - (21%)
Similarity:126/400 - (31%) Gaps:159/400 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IRATVPVTKQRIIVKQPSKWKIWKKTEKITEIYDSEEEQVT---HRLVRECCPGYLQVESGLCEP 91
            |.|..|.|:::::..:.|...:.     :..:|.:...||.   ||...:||.|:.: ..|.|.|
Human   133 ILAPSPQTQRKLLASRDSFCMVC-----VGVVYRTVYRQVVKTDHRQRLQCCHGFYE-SRGFCVP 191

  Fly    92 ICSRGCPAHASCAAPDRCECISGYVSARNHQDGSHYCE-----PICETP---------------- 135
            :|::.| .|..|.||::|:|:.|:    ...|.|..|.     |.|:.|                
Human   192 LCAQEC-VHGRCVAPNQCQCVPGW----RGDDCSSECAPGMWGPQCDKPCSCGNNSSCDPKSGVC 251

  Fly   136 -CPAGAQ---CVTPNT------------------------------------------------- 147
             ||:|.|   |:.|.|                                                 
Human   252 SCPSGLQPPNCLQPCTPGYYGPACQFRCQCHGAPCDPQTGACFCPAERTGPSCDVSCSQGTSGFF 316

  Fly   148 -------------------CACRDGYTQL---QPTDDGVSG-GCAPVCRVGDGCANGKCID--VD 187
                               |:|..|:...   .|..:|..| .|:..||    |.||...|  ..
Human   317 CPSTHSCQNGGVFQTPQGSCSCPPGWMGTICSLPCPEGFHGPNCSQECR----CHNGGLCDRFTG 377

  Fly   188 RCACNSGYRWDKAEERC-IELSAESISEELETTEDNTDSPSTSSTAV---FTATH-----CPDDF 243
            :|.|..||..|:..|.| :....:..:|..:...|....|:..:...   ||...     |||.|
Human   378 QCRCAPGYTGDRCREECPVGRFGQDCAETCDCAPDARCFPANGACLCEHGFTGDRCTDRLCPDGF 442

  Fly   244 --VLFRGEC---REKQFD----SNDVGCLKS-----------------GCGPHQTCL-------D 275
              :..:..|   ||....    :.:..||..                 ||..|..||       .
Human   443 YGLSCQAPCTCDREHSLSCHPMNGECSCLPGWAGLHCNESCPQDTHGPGCQEHCLCLHGGVCQAT 507

  Fly   276 SGVCQCSDGY 285
            ||:|||:.||
Human   508 SGLCQCAPGY 517



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.