DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and NimB4

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster


Alignment Length:336 Identity:78/336 - (23%)
Similarity:111/336 - (33%) Gaps:118/336 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 YDSEEEQVTH-------RLVRECCPGYLQV----------------ESGL--------------- 88
            ||.|.:.|.:       .::..||.|:.:.                |:|.               
  Fly   103 YDKEVKIVGNSSTNPYMNVIEVCCKGWRRYEYDWSQCVPDCGERCQENGFCVAGGKCVCFTDFVL 167

  Fly    89 -----CEPICSRGCPAHASCAAPDRCECISGYVSARNHQDGSH-YCEPICETPCPAGAQCVTPNT 147
                 |.|.|..||| |..|.....|:|..||     ..|||. :|:|.|...|.....|:.|..
  Fly   168 NYRNNCVPTCPLGCP-HGRCYLNGTCQCDKGY-----ELDGSRKFCQPQCNATCGHNEVCLEPGK 226

  Fly   148 CACRDGYTQLQPTDDGVSGGCAPVCRVGDG--------------------------------CAN 180
            |:|.:|||  :...:..:.||.|:|....|                                |.|
  Fly   227 CSCAEGYT--RGLRESAALGCQPICIPDCGYGHCVRPNECECFPGFQKRKNGITCEGDCYMTCEN 289

  Fly   181 GKCIDVDRCACNSGYRWDKAEERCIELSAESISEELETTEDNTDSPSTSSTAVFTATHCPDDFVL 245
            |.|.:...|.|.:|||:||....|           |....||.|:....|         |.:...
  Fly   290 GFCANKTTCVCQNGYRYDKNTTTC-----------LPDCGDNCDNGVCIS---------PGNCRC 334

  Fly   246 FRGECREKQFDSNDVGCLKSGCGPHQTCLDSGVCQCSDGYVPE------ESGEATGVLSCRRTLL 304
            |:|..|.:  :..:..|: .|||.:..|:...||.|:....||      |.|....:..||..  
  Fly   335 FKGYVRNR--ERCEAVCV-GGCGFYGKCIAPNVCGCAIVPGPERTYQRCEYGLCNAMGRCRCQ-- 394

  Fly   305 DQILGLNEAID 315
               :|:...||
  Fly   395 ---VGMTRFID 402



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469388
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D97941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.