DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and NimB1

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster


Alignment Length:364 Identity:82/364 - (22%)
Similarity:117/364 - (32%) Gaps:129/364 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SIAANAERDNY-CERNETIRATVPVTKQRIIVKQPSKWKIWKKTEKITEIYDSEEEQVTHRLVRE 76
            |::...||..: |.|.      ||              .::.:||:.:.:..:......|| :..
  Fly    47 SLSQTRERQQHLCHRE------VP--------------SVFFQTERDSPVRGNGSTIYFHR-IEV 90

  Fly    77 CCPGYLQ-VESGLCEPICSRGCP---AHASCAAPDRCECISGYVSARNH---------------- 121
            ||.||.: ..:..|.|.||...|   .:..|.:|..|||.:.:|  ||.                
  Fly    91 CCAGYRRDPYANECVPDCSASSPDNCRNGFCRSPGVCECFAEFV--RNEHGACIHTCPIACQHGR 153

  Fly   122 ----------------QDGSHYCEPICETPCPAGAQCVTPNTCACRDGYTQLQPTDDGVSGGCAP 170
                            |:...:|.|.|...|....:||.|..|.|..||.:   |.|   .||.|
  Fly   154 CYLNGTCVCHQNFVLDQETRQFCRPKCSQSCGTHEECVAPGQCDCSPGYRR---TPD---LGCQP 212

  Fly   171 VCRVGDGCANGKCIDVDRCACNSGY----RWDKAEERCIELSAESISEELETTEDNTDSPSTSST 231
            ||  ...|..|||:..::|.|.:|:    .|:..|..|.......:.|.                
  Fly   213 VC--APDCGFGKCVAPNQCECFAGFIKRPNWNVCEAECYLNCENGLCES---------------- 259

  Fly   232 AVFTATHCPDDFVLFRGECRE-KQFDSNDVGCL---KSGCGP-HQTCLDSGVCQCSDGY------ 285
                         .::..||| .::|.|...||   ...||. :..|:..|||:|..||      
  Fly   260 -------------RYKCHCREGYRYDVNTTSCLPECSDNCGQGNGVCIAPGVCRCFRGYEVHGAE 311

  Fly   286 -----------------VPEESGEATGVLSCRRTLLDQI 307
                             .||..|...|...||....|.|
  Fly   312 CRPKCESRFCGKYGRCVAPEICGCGEGQQHCRNGSCDDI 350



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469385
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D97941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.