DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and Megf8

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_609180.3 Gene:Megf8 / 34099 FlyBaseID:FBgn0031981 Length:2892 Species:Drosophila melanogaster


Alignment Length:286 Identity:69/286 - (24%)
Similarity:90/286 - (31%) Gaps:105/286 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 ECCPGYLQVES-------GLC-------EPICSRGCPAHASCAAPDRCECISGYVSARN-----H 121
            |.|..|.|..|       |.|       :.||:.|...|.. ..|....|...|.|.||     |
  Fly  2147 EPCHVYTQCSSCLEHAHCGWCAREGFNGDGICTEGALEHKQ-EHPSGSTCDLIYASWRNDSQLTH 2210

  Fly   122 QD-----------------GSHYCEPICETPCPAGAQCVTPNT-----CACRDGYTQLQPTDDGV 164
            .|                 |.|.|:.:.|       ||:..:|     |.|..||.:.|      
  Fly  2211 ADVVSWHYVQCPAENECINGHHNCDTVSE-------QCIDLDTAVGYKCVCAQGYREEQ------ 2262

  Fly   165 SGGCAPVCRVGDGCANGKCIDVDRCACNSGYRWDKAEERCIELSAESISEELETTEDNTDSPSTS 229
             |.|.|||  ..||..|.|:..|:|.|:.||.......:|:             ...:::..|:|
  Fly  2263 -GACLPVC--SQGCVRGNCVSPDQCQCDFGYVGANCSIQCL-------------CNGHSNCESSS 2311

  Fly   230 STAVFTATH-------CPDDFVLFRGECREKQFDSNDVGCLKSGCGPHQTCLD-----SGVCQCS 282
            ...:....|       |.....||.|..||..           .|.|   |||     |.||...
  Fly  2312 RLDICLKCHNNTMGEQCEKCQPLFVGNPREGH-----------ACQP---CLDYCHGHSDVCVAY 2362

  Fly   283 DGYVPEESGEATGVLSCRRTLLDQIL 308
            |.        ...|.:..|:.|::||
  Fly  2363 DA--------DPAVFNMTRSELERIL 2380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC4NP_609698.2 None
Megf8NP_609180.3 CUB 33..141 CDD:238001
KELCH repeat 228..268 CDD:276965
Kelch_4 369..414 CDD:290154
KELCH repeat 370..420 CDD:276965
KELCH repeat 425..476 CDD:276965
KELCH repeat 480..540 CDD:276965
EGF_3 1186..1220 CDD:289699
EGF_Lam 1257..1302 CDD:238012
EGF_Lam 1304..1354 CDD:238012
CUB 1372..1484 CDD:238001
Kelch_4 1584..1628 CDD:290154
KELCH repeat 1585..1638 CDD:276965
KELCH repeat 1642..1685 CDD:276965
Kelch_3 1656..1710 CDD:290151
KELCH repeat 1760..1813 CDD:276965
Kelch_4 1760..1802 CDD:290154
KELCH repeat 1817..1867 CDD:276965
EGF_Lam 2299..2346 CDD:238012 10/70 (14%)
EGF_Lam 2422..2487 CDD:238012
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.