DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and CG11674

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster


Alignment Length:283 Identity:68/283 - (24%)
Similarity:100/283 - (35%) Gaps:67/283 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 HRLVRECCPGYLQVESGLCEPICSRGCPAHASCAAPDRCECISGYVSARNHQDGSHY-CEPICE- 133
            ||.:.....|:|  .:|..|.:....|.:.|.||..:|..|:...........|... |.|:.| 
  Fly     5 HRWILLLLAGFL--ATGRAEDLLELSCSSDAQCAQFERGRCVDMACICTARGSGERVPCTPLEER 67

  Fly   134 ----------TPCP-AGAQCVTP-NTCACRDGYTQLQPTDDGVSGGCAP-VCRVGDGCA-NGKCI 184
                      .||| ..|.|.|. ..|.|.:|:..   :||  ...|.| |..||..|. ..:|.
  Fly    68 LKLTNIIGGACPCPMPNAICHTRWQQCHCSEGHVS---SDD--RRRCLPAVVPVGGSCEFQQQCQ 127

  Fly   185 DVDR--------CACNSGYRWDKAEERCIELSAESISEELETTEDNTDSPSTSSTAVFTATH--- 238
            ..||        |.|.:.:.:.  |.||:.:...|..|:       .|..|..::...|.|.   
  Fly   128 RADRFSSCIGNQCLCLNQFEFH--EGRCLSVLQSSCLED-------KDCGSCGASICLTKTKRCG 183

  Fly   239 CPDDFVLFRGECREKQFDSNDVGCLKSGCGPHQTCLDSGVCQCSDGYVPEESGEATG-----VLS 298
            |..:||          .:.|...|:| |.....||..|..|:.:.|        |.|     :..
  Fly   184 CSKNFV----------HNHNMTKCIK-GSAYGDTCEHSSPCKLNLG--------ADGRCLDHLCV 229

  Fly   299 CRRTLLDQILGLNEAIDDDDELN 321
            ||.|...:.:....|.|::|:|:
  Fly   230 CRSTHYPKRVANEVAKDENDDLD 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC4NP_609698.2 None
CG11674NP_572948.1 EB 96..153 CDD:279949 16/63 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.