DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and NimA

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster


Alignment Length:404 Identity:98/404 - (24%)
Similarity:148/404 - (36%) Gaps:95/404 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFIWALILVLGSIAANAERDNYCERNETIRATVPVTKQRIIVKQPSKWKI-------WKKTEKI 58
            :|.|.|.::.|.||....   |.|.|.|.....|.|.:.:.:..:.|.|.:       ..||| :
  Fly    34 VKDIEAGVVALPSIQGPG---NICIREEPYVEHVQVPEMQPVRVRTSSWCMEIPPRCATFKTE-M 94

  Fly    59 TEIYDSEEEQVTHRLVRECCPGY---LQVESGLCEPICSRGCPAHASCAAPDRCECISGYVSARN 120
            .|:...::...| |.||.||.||   |......|:|||..|| ...||..||.|.|..||:....
  Fly    95 REVMRVQKLNKT-RTVRFCCQGYEGNLSDSQATCKPICRGGC-GRGSCVMPDICSCEEGYIGKHC 157

  Fly   121 HQDGSH-----YCEPICETPCPAGAQCVTPN-TCACRDGYT----QLQPTDDGVSGGCAPVCRVG 175
            .|...|     .|:.:|:  |..||.|...: .|.|..|:|    :| |...|..|   .:||  
  Fly   158 TQRCDHDRWGLDCKNLCQ--CQNGAACDNKSGLCHCIAGWTGQFCEL-PCPQGTYG---IMCR-- 214

  Fly   176 DGCANGKCIDVDRCACNSGYRWDKAEERCIELSAESISEELETTEDNTDSPSTSSTAVFTATHCP 240
                  |..|.|...||........:::.::|   ::|..:..|.::|...........|....|
  Fly   215 ------KACDCDEKPCNPQTGACIQQDQPLQL---NVSHVIVETVNSTLEKMGIIPRPTTPVPLP 270

  Fly   241 DDFVLFRGECREKQFDSNDVGCLKSGCGPHQTCLD-----------------------SGVCQCS 282
            :..|:       ||..||:..........||:..|                       :|:....
  Fly   271 EVIVI-------KQPTSNENAQHSPKIIVHQSSSDLLENLHTAAAAGVPTPEVIHVITNGITSPQ 328

  Fly   283 D---GYVPEESGEATGVLSCRRTLLDQILGLNEAIDDDDELNPWTIPIIGVACGFLFVLLIVGLL 344
            :   |:|   .|||.   |.:....|...||...:     ::...:.::.:|.|.|:|.      
  Fly   329 EHLAGFV---GGEAN---SSQTATADHQSGLVVTL-----VSIMLLLLVAIAVGSLYVY------ 376

  Fly   345 GGRRYRQERAALAN 358
              |||..:.||:.|
  Fly   377 --RRYHHKNAAVYN 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC4NP_609698.2 None
NimANP_001285918.1 EMI 52..116 CDD:284877 18/65 (28%)
EGF_2 170..200 CDD:285248 10/31 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.