DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and Megf10

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001094127.1 Gene:Megf10 / 291445 RGDID:735084 Length:1145 Species:Rattus norvegicus


Alignment Length:341 Identity:82/341 - (24%)
Similarity:115/341 - (33%) Gaps:84/341 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 NAERDNYCERNE----TIRATVPVTKQRIIVKQPSKWKIWKKTEKITEIYDS---EEEQVTHRLV 74
            |.|..|.|...|    |::.:.|....:|.....:....|.|..:....|.:   ..|:..:|..
  Rat    27 NLEDPNVCSHWESYSVTVQESYPHPFDQIYYTSCTDILNWFKCTRHRVSYRTAYRHGEKTMYRRK 91

  Fly    75 RECCPGYLQVESGLCEPICSRGCPAHASCAAPDRCECISGY--VSARNHQDGSHY---------- 127
            .:||||:.: ...:|.|.|:..| .|..|.||:.|:|..|:  .:..:..||.|:          
  Rat    92 SQCCPGFYE-SRDVCVPHCADKC-VHGRCIAPNTCQCEPGWGGTNCSSACDGDHWGPHCSSRCQC 154

  Fly   128 -----CEPI--------------CETPCPAG---------AQCVTPNT-------CACRDGYTQL 157
                 |.||              ||..|..|         .||....|       |.|..|||..
  Rat   155 KNRALCNPITGACHCAAGYRGWRCEDRCEQGTYGNDCHQRCQCQNGATCDHITGECRCSPGYTGA 219

  Fly   158 QPTDDGVSGGCAPVCRVGDGCAN-GKCIDV-DRCACNSGYRWDKAEERCIE-LSAESISEELETT 219
            ...|....|...|.|.....|.| |.|..| ..|:|.||:......:.|.| ...::.|:|.:..
  Rat   220 FCEDLCPPGKHGPQCEQRCPCQNGGVCHHVTGECSCPSGWMGTVCGQPCPEGRFGKNCSQECQCH 284

  Fly   220 EDNTDSPSTSSTAVFTATHCPDDFVLFRGE-CREKQFDSNDVGCLKSGCGPHQTCLD-------S 276
            .......:|..      .||...:.   || |:    |...||.....|.....|::       |
  Rat   285 NGGACDAATGQ------CHCSPGYT---GERCQ----DECPVGTYGVRCAETCRCVNGGKCYHVS 336

  Fly   277 GVCQCSDGYVPEESGE 292
            |.|.|..|:    |||
  Rat   337 GTCLCEAGF----SGE 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC4NP_609698.2 None
Megf10NP_001094127.1 EMI 32..99 CDD:400092 15/66 (23%)
EGF_Lam 281..318 CDD:214543 9/49 (18%)
EGF_CA 542..587 CDD:419698
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.