DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and Scarf2

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_038944006.1 Gene:Scarf2 / 287949 RGDID:1306013 Length:838 Species:Rattus norvegicus


Alignment Length:345 Identity:81/345 - (23%)
Similarity:107/345 - (31%) Gaps:140/345 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 CCPGYLQVE---------SGLCEP-----IC-----SRGCPAHASC------------------- 103
            |.||:...:         :..|:|     :|     .|.|....||                   
  Rat   164 CEPGWWGAQCASACYCSATSRCDPQTGACLCHAGWWGRSCNNQCSCNSSPCEQQSGRCQCRERTF 228

  Fly   104 -AAPDR-CECISGYVSARNHQ-DGSHYCEP-----ICETPCPAG----------AQCVTPNTC-- 148
             |..|| |:|..|    |.|. ||:..|:|     .|..|||||          .||.....|  
  Rat   229 GARCDRYCQCFRG----RCHPVDGTCACDPGYRGKYCREPCPAGFYGLGCRRRCGQCKGQQPCTV 289

  Fly   149 ------ACRDGYTQL---QPTDDGVSG-GC---APVCRVGDGC--ANGKCIDVDRCACNSGYRWD 198
                  .|..|:...   ||...|..| ||   .|.||.|..|  ..|||..     ||:|:..|
  Rat   290 VEGRCLTCEPGWNGTKCDQPCATGFYGEGCGHRCPPCRDGHACNHVTGKCTH-----CNAGWIGD 349

  Fly   199 KAEERCIELSAESISEELETTEDNTDSPSTSSTAVFTATHCPDDFVLFRGECREKQFDSNDVGCL 263
            :.|.:|   |..:..|:                ..|..:.|..      |.|   .|.|....|.
  Rat   350 RCETKC---SNGTYGED----------------CAFVCSDCGS------GHC---DFQSGRCLCS 386

  Fly   264 KSGCGPH--QTC------LD-SGVCQCSD-------GYVPEESGEATGVLSCRRTLLDQILGLNE 312
            ....|||  .||      :| :..|.|.:       |....|:.:..||:.. ..||..:|||  
  Rat   387 PGVHGPHCNVTCPAGLHGVDCAQACSCHEESCDPVTGACHLETNQRKGVMGA-GALLTLLLGL-- 448

  Fly   313 AIDDDDELNPWTIPIIGVAC 332
                       .:.::|..|
  Rat   449 -----------LLSLLGCCC 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC4NP_609698.2 None
Scarf2XP_038944006.1 exchanger_TraA <74..431 CDD:411343 72/303 (24%)
PHA03247 <683..837 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.