DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and NimB2

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster


Alignment Length:219 Identity:68/219 - (31%)
Similarity:89/219 - (40%) Gaps:55/219 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 ECCPGY-LQVES-GLCEPICSRGCPAHASCAAPDRCECISGYVSARNHQDGSHYCEPICETPCPA 138
            :|..|| |:.|: ..|:|.|..|| :...|.||::|.|:.||   |...|||  |||:|:: |..
  Fly   234 KCREGYSLEPETRKYCQPECKPGC-SFGRCVAPNKCACLDGY---RLAADGS--CEPVCDS-CEN 291

  Fly   139 GAQCVTPNTCACRDGYTQLQPTDDGVSGGCAPVCRVGDGCANGKCIDVDRCACNSGYRWDKAEER 203
            | :|..|..|.|..||.:||       |.|.|:|.:  .|.||:||..|.|.|.||:.||:....
  Fly   292 G-KCTAPGHCNCNAGYLKLQ-------GRCEPICSI--PCKNGRCIGPDICECASGFEWDRKSAE 346

  Fly   204 CIELSAESISEELETTEDNTDSPSTSSTAV-------------------FTATHCPDDFVLFRGE 249
            |:               ...|.|..:...|                   ....|||..  ...|.
  Fly   347 CL---------------PKCDLPCLNGVCVGNNQCDCKTGYVRDEHQRNICQPHCPQG--CQNGY 394

  Fly   250 CREKQFDSNDVGCLKSGCGPHQTC 273
            |....|.....|.:|||....|||
  Fly   395 CSAPNFCICRPGFIKSGIKGRQTC 418



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469387
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D97941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.