DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and STAB1

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_016861487.1 Gene:STAB1 / 23166 HGNCID:18628 Length:2615 Species:Homo sapiens


Alignment Length:423 Identity:90/423 - (21%)
Similarity:136/423 - (32%) Gaps:148/423 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 CERNETIRATVPVTKQRIIVKQ--PSKWKIWKKTEKITE--IYDSE---------------EEQV 69
            |:...|....||.|....|.||  ||.| :.:..::||:  .|:.:               .:||
Human    32 CDVKTTFVTHVPCTSCAAIKKQTCPSGW-LRELPDQITQDCRYEVQLGGSMVSMSGCRRKCRKQV 95

  Fly    70 THRLVRECCPGYLQVESGLCEPICSRGCPAHAS------------------------CAAPDR-- 108
            ..   :.|||||.......|.......|..|.:                        |..|:|  
Human    96 VQ---KACCPGYWGSRCHECPGGAETPCNGHGTCLDGMDRNGTCVCQENFRGSACQECQDPNRFG 157

  Fly   109 ------CECISGYVSARNHQDGSHYC------------EPIC-ETPCPAGAQC-VTPNTCACRDG 153
                  |.|:.|..:.....|||..|            .|:| |..||...|| ....:|.|..|
Human   158 PDCQSVCSCVHGVCNHGPRGDGSCLCFAGYTGPHCDQELPVCQELRCPQNTQCSAEAPSCRCLPG 222

  Fly   154 YTQLQPTDDGVSGGCAPVCRVGDGCANGKCIDVDRCACNSGYRWDKAEERCIELSAESISEELET 218
            ||| |.::          ||..:.|....|..:.:|:.:     .|.:.:|              
Human   223 YTQ-QGSE----------CRAPNPCWPSPCSLLAQCSVS-----PKGQAQC-------------- 257

  Fly   219 TEDNTDSPSTSSTAVFTATHCPDDFVLFRGE---CREKQFDSNDVGCLKSGCGPHQT-CL----D 275
                               |||::   :.|:   |..|...::::|    ||..:.| |:    .
Human   258 -------------------HCPEN---YHGDGMVCLPKDPCTDNLG----GCPSNSTLCVYQKPG 296

  Fly   276 SGVCQCSDGYVPEESGEATGV------LSCRRTLLDQIL--GLNEAIDDDDELNPWTIPIIGVAC 332
            ...|.|..|.|...|..:.|.      .||.|:...|:.  |....:..:.|:..      |.||
Human   297 QAFCTCRPGLVSINSNASAGCFAFCSPFSCDRSATCQVTADGKTSCVCRESEVGD------GRAC 355

  Fly   333 -GFLFVLLIVGLLGGRRYRQERAALANKEMECQ 364
             |.|...:......||.:.|.|.|:|..:..|:
Human   356 YGHLLHEVQKATQTGRVFLQLRVAVAMMDQGCR 388



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.