DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and Megf6

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001156449.1 Gene:Megf6 / 230971 MGIID:1919351 Length:1572 Species:Mus musculus


Alignment Length:395 Identity:101/395 - (25%)
Similarity:135/395 - (34%) Gaps:125/395 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 CCPGY-LQVESGLCEPI--C---SRGCPAHASCAAPDR--CECISGYVSARNHQDGSHYCEPICE 133
            |.||| ||.:...|:.:  |   :.|| .|.....|..  |||..|:   |.|.|| ..|..|  
Mouse   148 CPPGYQLQGDGKTCQDVDECRSHNGGC-QHRCVNTPGSYLCECKPGF---RLHTDG-RTCLAI-- 205

  Fly   134 TPCPAG-----AQC----VTPNTCACRDGYTQLQ----------PTDDGVSGGCAPVCR-----V 174
            :.|..|     .||    ||.:.|.||..| |||          |..|| :|||...|:     .
Mouse   206 SSCTLGNGGCQHQCVQLTVTQHRCQCRPQY-QLQEDGRRCVRRSPCADG-NGGCMHTCQELRGLA 268

  Fly   175 GDGCANG--------KCIDVDRCA--------------------CNSGYRWDKAEERCIELSAES 211
            ..||..|        .|.|||.||                    |::||.......:|..:..| 
Mouse   269 HCGCHPGYQLAADRKACEDVDECALGLAQCAHGCLNTQGSFKCVCHAGYELGADGRQCYRIEME- 332

  Fly   212 ISEELETTEDNTDSPSTSSTAVFTATHCPDDFVLFRGECREKQFDSNDVGCLKSGCGPHQTCLDS 276
            |....|...... |...|.|:......||..:.|  .|.::...|.:|  |..|.| ..|.|.::
Mouse   333 IVNSCEAGNGGC-SHGCSHTSTGPLCTCPRGYEL--DEDQKTCIDIDD--CANSPC-CQQVCANT 391

  Fly   277 -GVCQCS---------DGYVPEESGE-ATGVLSCRRTL----------------LDQ----ILGL 310
             |..:||         ||...|:..| |:|...|....                ||:    ...|
Mouse   392 PGGYECSCFAGYRLNTDGCGCEDVDECASGHSGCEHHCSNLAGSFQCFCEAGYRLDEDRRGCTPL 456

  Fly   311 NEAIDDDDELNPWTIPIIGVACGFLFVLLIVGLLGGR-------RYRQERAALANKEMECQYSQK 368
            .|::.|.|...|:..|:..:|           :||..       .|..|..|:|....|...::|
Mouse   457 EESVVDLDGQLPFVRPLPHIA-----------VLGDELPQLFQDDYGAEEEAVAELRGEHTLTEK 510

  Fly   369 TVDVD 373
            .|.:|
Mouse   511 FVCLD 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC4NP_609698.2 None
Megf6NP_001156449.1 EMI 42..111 CDD:284877
FXa_inhibition 126..161 CDD:291342 6/12 (50%)
vWFA <153..201 CDD:294047 16/52 (31%)
vWFA <236..284 CDD:294047 13/48 (27%)
vWFA <283..324 CDD:294047 9/40 (23%)
FXa_inhibition 337..372 CDD:291342 8/37 (22%)
vWFA <370..409 CDD:294047 10/41 (24%)
vWFA <412..451 CDD:294047 7/38 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.