DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and Scarf2

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_036015777.1 Gene:Scarf2 / 224024 MGIID:1858430 Length:838 Species:Mus musculus


Alignment Length:341 Identity:79/341 - (23%)
Similarity:109/341 - (31%) Gaps:132/341 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 CCPGYLQVE---------SGLCEP-----IC-----SRGCPAHASC-AAP-----DRCECISGYV 116
            |.||:...:         :..|:|     :|     .|.|....:| ::|     .||:|.....
Mouse   164 CEPGWWGAQCASACYCSATSRCDPQTGACLCHVGWWGRSCNNQCACNSSPCEQQSGRCQCRERMF 228

  Fly   117 SAR-------NH-----QDGSHYCEP-----ICETPCPAG----------AQCVTPNTC------ 148
            .||       :|     .||:..|:|     .|..|||||          .||.....|      
Mouse   229 GARCDRYCQCSHGRCHPVDGTCACDPGYRGKYCREPCPAGFYGPGCRRRCGQCKGQQPCTVVEGR 293

  Fly   149 --ACRDGYTQL---QPTDDGVSG-GC---APVCRVGDGC--ANGKCIDVDRCACNSGYRWDKAEE 202
              .|..|:...   ||...|..| ||   .|.||.|..|  ..|||..     ||:|:..|:.|.
Mouse   294 CLTCEPGWNGTKCDQPCATGFYGEGCGHRCPPCRDGHACNHVTGKCTH-----CNAGWIGDRCET 353

  Fly   203 RCIELSAESISEELETTEDNTDSPSTSSTAVFTATHCPDDFVLFRGECREKQFDSNDVGCLKSGC 267
            :|   |..:..|:                ..|..:.|..      |.|   .|.|....|.....
Mouse   354 KC---SNGTYGED----------------CAFVCSDCGS------GHC---DFQSGRCLCSPGVH 390

  Fly   268 GPH--QTC------LD-SGVCQCSD-------GYVPEESGEATGVLSCRRTLLDQILGLNEAIDD 316
            |||  .||      :| :..|.|.:       |....|:.:..||:.. ..||..:|||      
Mouse   391 GPHCNVTCPAGLHGVDCAQACSCHEESCDPVTGACHLETNQRKGVMGA-GALLTLLLGL------ 448

  Fly   317 DDELNPWTIPIIGVAC 332
                   .:.::|..|
Mouse   449 -------LLSLLGCCC 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC4NP_609698.2 None
Scarf2XP_036015777.1 exchanger_TraA <74..431 CDD:411343 70/299 (23%)
PHA03307 526..>836 CDD:223039
PHA03247 <683..838 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.