DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and Megf11

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_006511049.1 Gene:Megf11 / 214058 MGIID:1920951 Length:1138 Species:Mus musculus


Alignment Length:387 Identity:88/387 - (22%)
Similarity:129/387 - (33%) Gaps:120/387 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LILVLGSIAANAERDNYCERNETIRATVPVTK----QRIIVKQPSKWKIWKKTEKITEIYDSEEE 67
            :.|:..::|.|.|..|.|...|:...||..:.    .:|...:.:....|.|..:....|.:...
Mouse    10 VFLLQAALALNPEDPNVCSHWESYAVTVQESYAHPFDQIYYTRCADILNWFKCTRHRISYKTAYR 74

  Fly    68 QVTHRLVR---ECCPGYLQVESG-LCEPICSRGCPAHASCAAPDRCECISGY--VSARNHQDGSH 126
            :....:.|   :|||||  .|:| .|.|:|:..| .|..|.:||.|.|..|:  ....:..|..|
Mouse    75 RGLRTMYRRRSQCCPGY--YENGDFCIPLCTEEC-MHGRCVSPDTCHCEPGWGGPDCSSGCDSEH 136

  Fly   127 Y---------------CEPI--------------CETPCPAG---------AQC-----VTPNT- 147
            :               |.||              ||..|..|         .||     ..|.| 
Mouse   137 WGPHCSNRCQCQNGALCNPITGACVCAPGFRGWRCEELCAPGTHGKGCQLLCQCHHGASCDPRTG 201

  Fly   148 -CACRDGYTQLQ------------------PTDDG-----VSGGCA-------PVC-------RV 174
             |.|..|||.:.                  |..:|     ::|.||       .||       ..
Mouse   202 ECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTF 266

  Fly   175 GDGCA-------NGKCIDV-DRCACNSGYRWDKAEERC-IELSAESISEELETTEDNTDSPSTSS 230
            |..|:       .|:|..| .:|.|.:||..|:.:|.| ........|:..:.......||:|. 
Mouse   267 GQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDRCQEECPFGTFGFLCSQRCDCHNGGQCSPATG- 330

  Fly   231 TAVFTATHCPDDFVLFRG-ECREKQFDS--NDVGC-LKSGCGPHQT--CLD-SGVCQCSDGY 285
                 |..|...   ::| .|:|:....  :..|| |...|....|  |.. :|.|.|..|:
Mouse   331 -----ACECEPG---YKGPSCQERLCPEGLHGPGCTLPCPCDTENTISCHPVTGACTCQPGW 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC4NP_609698.2 None
Megf11XP_006511049.1 EMI 25..92 CDD:400092 15/68 (22%)
EGF_CA 188..233 CDD:419698 9/44 (20%)
EGF_CA 274..319 CDD:419698 11/44 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.