DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and C53B7.2

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_509154.2 Gene:C53B7.2 / 183744 WormBaseID:WBGene00016893 Length:169 Species:Caenorhabditis elegans


Alignment Length:241 Identity:50/241 - (20%)
Similarity:76/241 - (31%) Gaps:110/241 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 IYDSEEEQVTHRLVRECCPGYLQVESGLCEPI--CSRGCPAHASCAAPD----------RCECIS 113
            :.||:..|.|           .||..|:.|..  |::.||  .:|.:|:          .|.|:.
 Worm    15 VVDSQYHQTT-----------TQVSCGINEQYSPCTQMCP--PTCESPNPQCRVDCTRPSCTCLP 66

  Fly   114 GYVSARNHQDGSHYCEPICETPCPAGAQCVTPNTC------ACRDGYTQLQPTDDGVSGGCAPVC 172
            |:|.:.:.                   ||:..|:|      .||       ..:|         |
 Worm    67 GHVYSNSR-------------------QCIPANSCYQTQSLRCR-------MNND---------C 96

  Fly   173 RVGDGCANGKCIDVDRCACNSGYRWDKAEERCIELSAESISEELETTEDNTDSPSTSSTAVFTAT 237
            |.|..|.||.|                          .:.|.....|..::.|.|:||:.....:
 Worm    97 RPGMYCINGYC--------------------------GAASGVYTRTVVSSSSLSSSSSGHRHHS 135

  Fly   238 HCPDDFVLFRGECREKQFDSNDVGCLKSGCGPHQTCLDSGVCQCSD 283
            |      ..:|||      |.||     .|...:.|:| |:|..:|
 Worm   136 H------RSQGEC------SLDV-----HCDHRKICID-GICVYAD 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC4NP_609698.2 None
C53B7.2NP_509154.2 TIL 29..82 CDD:366828 14/73 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.