DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and dsl-2

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_500052.1 Gene:dsl-2 / 176938 WormBaseID:WBGene00001104 Length:322 Species:Caenorhabditis elegans


Alignment Length:89 Identity:20/89 - (22%)
Similarity:32/89 - (35%) Gaps:27/89 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 EEQVTHRLVREC-CPGYLQVESGLCEPICSR---------GCPAHASC-AAPD--------RCEC 111
            :|...|.:...| ..|.:....|.|.|.|.:         .|...|.| ::.|        .|||
 Worm   136 DEDAAHLVGMRCNKKGVMGCNEGFCGPNCDQTKSQCSMMCACENDAPCYSSTDPRTSREYVYCEC 200

  Fly   112 ISGYVSARNHQDGSHYCEPICETP 135
            ::|:       :|. ||:.:...|
 Worm   201 LTGF-------EGK-YCQNVTFPP 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC4NP_609698.2 None
dsl-2NP_500052.1 DSL 102..164 CDD:128366 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.