DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and F56B3.2

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_499983.2 Gene:F56B3.2 / 176902 WormBaseID:WBGene00018928 Length:432 Species:Caenorhabditis elegans


Alignment Length:312 Identity:69/312 - (22%)
Similarity:96/312 - (30%) Gaps:118/312 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SGLCE---PICSRGCPAHASCAAPDRCECISGYVSARNHQDGSHYCEPICETPCPAGAQCVTPNT 147
            :|.||   .||.||           :|.|...|...|:.:.....|.|:   |...||:|  .:.
 Worm    41 NGDCENKGSICLRG-----------KCRCHPHYTETRDEKGRLPKCAPL---PAKIGARC--SSK 89

  Fly   148 CA----CRDGYTQ-LQPTDDGVSGG-CAPVCRVGD-------------GCANGKCIDV------- 186
            |.    ||:|..| :|.....||.| |....||||             .|.|.:|:.:       
 Worm    90 CREPLFCRNGECQCVQRGTTRVSNGECITTSRVGDRCSRHYDCTSPFSACVNSQCVCITGTIQMG 154

  Fly   187 DRCACNSGYRWDKAE-ERCIELSAESISEELETTEDN---------------------------- 222
            .||...:...:.|.. :.|:..|..|::..:.:.:||                            
 Worm   155 SRCVAAANCPFGKLPGQSCVRKSDPSLAFNIPSNQDNCPMGQVCITAGESQVGHCCPVICPLNTT 219

  Fly   223 TDSPSTSSTAVFTATHCPDD----FVLFRGE------CREK-----------QFDSNDVGCLKSG 266
            ||:..:.......|..||.|    :.|..|.      ||..           .:.....|.|.|.
 Worm   220 TDTRYSCDPDAAPALKCPSDSHYCYFLSDGSFSQAACCRRPCNAMAPNALYVDYHCMPRGQLNSA 284

  Fly   267 C--------GPHQTCLDSGVCQCSDGYVPEESGEATGVL---------SCRR 301
            |        |....|: .|.|||...:.|     |..||         ||.|
 Worm   285 CTSNAQCGGGEGMECM-KGQCQCQQNFHP-----AVDVLTNPLKNPSQSCSR 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC4NP_609698.2 None
F56B3.2NP_499983.2 EB 111..157 CDD:279949 11/45 (24%)
EB 266..312 CDD:279949 10/46 (22%)
EB 332..383 CDD:279949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.