DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and D1044.7

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_498177.1 Gene:D1044.7 / 175758 WormBaseID:WBGene00017032 Length:400 Species:Caenorhabditis elegans


Alignment Length:274 Identity:57/274 - (20%)
Similarity:94/274 - (34%) Gaps:94/274 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 ECCPGYLQVESGLCEPICSRG--CP-AHASCAAPDRCECISGYVSARNHQDGSHYCEPICE--TP 135
            :|..||          |||.|  || .:::..:.....|.:|.:|.......|......|:  ..
 Worm    98 QCASGY----------ICSNGACCPNTNSNTCSTTGTPCFTGQISVGGQCFNSVNIGDRCQRSEQ 152

  Fly   136 CPAGAQCVTPNTCACRDGYTQLQPTDDGVSGGCAPVCRVGDGCANGKCIDV-------------- 186
            |..|:||.. |.|.|.:|:.       .|:..||  |::|....|.:||.:              
 Worm   153 CLGGSQCQN-NLCQCPNGFA-------NVNQKCA--CQLGTVLFNSQCITLASPGQNCQISSQCI 207

  Fly   187 -------DRCACNSGYRW----------DKAEE-------RCIELSAESISEELETTE------- 220
                   ..|:||..||.          .|.::       :|:.||.  :.|.....:       
 Worm   208 DNSVCNNQMCSCNGNYRLVFGYCVPFTNSKCQQTQTLVNNQCVLLSI--VGETCIANQQCVGGAM 270

  Fly   221 --DNTDSPSTSSTAVF--------TATHCPDDFVLFRGECREKQFDSNDVGCLKSGCGPHQTCL- 274
              ..|...:..:||::        |...|..:.|.:.|:|    :::.::|   ..|...|.|| 
 Worm   271 CNSGTCRCTNGATAMYGYCISSQSTVNPCNSNQVYYNGQC----YNTVNIG---FQCQITQQCLG 328

  Fly   275 ----DSGVCQCSDG 284
                .:..|||:.|
 Worm   329 NSQCQNSFCQCTSG 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC4NP_609698.2 None
D1044.7NP_498177.1 EB 126..177 CDD:279949 14/58 (24%)
EB 179..230 CDD:279949 10/50 (20%)
EB 238..289 CDD:279949 7/52 (13%)
EB 299..349 CDD:279949 13/51 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.