DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC4 and Dkk1

DIOPT Version :9

Sequence 1:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_034181.2 Gene:Dkk1 / 13380 MGIID:1329040 Length:272 Species:Mus musculus


Alignment Length:143 Identity:32/143 - (22%)
Similarity:47/143 - (32%) Gaps:49/143 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 CCPGYLQVESGLCEPICSRGCP-----------------AHASCAAPDRCECISGYVSARNHQDG 124
            ||||. ..::|:|.|......|                 |.|....|.|....|.....:. |:|
Mouse   130 CCPGN-YCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKG-QEG 192

  Fly   125 SHYCEPIC--ETPCPAGAQCVTPNTCACRDGYTQLQPTDDGVSGGCAPVCRVGDGCANGK----- 182
            |     :|  .:.|.||       .|..|..::::          |.||.:.|..|...|     
Mouse   193 S-----VCLRSSDCAAG-------LCCARHFWSKI----------CKPVLKEGQVCTKHKRKGSH 235

  Fly   183 CIDV-DRCACNSG 194
            .::: .||.|..|
Mouse   236 GLEIFQRCYCGEG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC4NP_609698.2 None
Dkk1NP_034181.2 Dickkopf_N 86..142 CDD:282549 5/12 (42%)
DKK-type Cys-1 86..141 5/11 (45%)
DKK-type Cys-2 195..269 16/71 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.